Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319CX65

Protein Details
Accession A0A319CX65    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-34DVVHARARRRFNRGLKRKPMGLBasic
NLS Segment(s)
PositionSequence
18-48RARRRFNRGLKRKPMGLIKKLRKAKQEAKPN
Subcellular Location(s) nucl 16, cyto_nucl 12.5, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR020934  Ribosomal_S15/S19_CS  
IPR002222  Ribosomal_S19  
IPR023575  Ribosomal_S19_S15_SF  
IPR005713  Ribosomal_S19A/S15e  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00203  Ribosomal_S19  
PROSITE View protein in PROSITE  
PS00323  RIBOSOMAL_S19  
Amino Acid Sequences MKLLDLSSEQLRDVVHARARRRFNRGLKRKPMGLIKKLRKAKQEAKPNEKPDLVKTHLRDMIVVPEMIGSVIGIYSGKEFNQIEVKPEMVGHYLGEFSISYKPVKHGRPGIGATHSSRFIPLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.28
4 0.34
5 0.41
6 0.51
7 0.55
8 0.61
9 0.64
10 0.69
11 0.74
12 0.79
13 0.82
14 0.82
15 0.82
16 0.78
17 0.73
18 0.73
19 0.7
20 0.69
21 0.69
22 0.67
23 0.71
24 0.75
25 0.75
26 0.72
27 0.72
28 0.72
29 0.71
30 0.73
31 0.73
32 0.74
33 0.77
34 0.74
35 0.7
36 0.63
37 0.55
38 0.48
39 0.45
40 0.4
41 0.37
42 0.34
43 0.35
44 0.35
45 0.34
46 0.3
47 0.24
48 0.22
49 0.18
50 0.16
51 0.1
52 0.08
53 0.08
54 0.07
55 0.06
56 0.03
57 0.02
58 0.02
59 0.02
60 0.02
61 0.03
62 0.04
63 0.05
64 0.05
65 0.09
66 0.09
67 0.11
68 0.17
69 0.17
70 0.2
71 0.2
72 0.21
73 0.17
74 0.17
75 0.17
76 0.12
77 0.12
78 0.09
79 0.08
80 0.08
81 0.08
82 0.08
83 0.07
84 0.07
85 0.1
86 0.12
87 0.12
88 0.13
89 0.19
90 0.26
91 0.3
92 0.37
93 0.41
94 0.45
95 0.5
96 0.52
97 0.51
98 0.48
99 0.47
100 0.43
101 0.4
102 0.36
103 0.3