Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319D571

Protein Details
Accession A0A319D571   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
84-115KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 11.5, cyto 4.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MMVSFRSALGASTGALRQFLPSLSRKSTGLVSRPFSQIARLSWTNGLRLLRSGKQNGNVGIASVETTLRQVEQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.11
5 0.12
6 0.12
7 0.15
8 0.18
9 0.23
10 0.26
11 0.27
12 0.27
13 0.28
14 0.32
15 0.33
16 0.35
17 0.35
18 0.36
19 0.37
20 0.39
21 0.38
22 0.33
23 0.31
24 0.27
25 0.23
26 0.25
27 0.23
28 0.23
29 0.26
30 0.26
31 0.24
32 0.24
33 0.23
34 0.17
35 0.18
36 0.2
37 0.19
38 0.23
39 0.26
40 0.25
41 0.28
42 0.3
43 0.29
44 0.27
45 0.23
46 0.19
47 0.15
48 0.12
49 0.09
50 0.06
51 0.06
52 0.04
53 0.05
54 0.05
55 0.05
56 0.06
57 0.07
58 0.09
59 0.16
60 0.21
61 0.22
62 0.25
63 0.26
64 0.26
65 0.28
66 0.36
67 0.35
68 0.38
69 0.4
70 0.41
71 0.49
72 0.51
73 0.52
74 0.51
75 0.53
76 0.55
77 0.6
78 0.65
79 0.66
80 0.73
81 0.78
82 0.77
83 0.79
84 0.8
85 0.79
86 0.78
87 0.78
88 0.76
89 0.77
90 0.79
91 0.75
92 0.75
93 0.77
94 0.81
95 0.82