Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319D559

Protein Details
Accession A0A319D559    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
46-67SGYTEKCEKRPGKSRRLRSTHLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 6.5, cyto_nucl 6, cyto 4.5, extr 3
Family & Domain DBs
Amino Acid Sequences MIESGRTGNAVACPITITWASSNTATLIGLTVGWSIIPRKILFGRSGYTEKCEKRPGKSRRLRSTHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.11
4 0.11
5 0.1
6 0.12
7 0.13
8 0.12
9 0.13
10 0.11
11 0.11
12 0.09
13 0.08
14 0.07
15 0.05
16 0.05
17 0.04
18 0.04
19 0.03
20 0.03
21 0.04
22 0.04
23 0.05
24 0.08
25 0.07
26 0.1
27 0.12
28 0.15
29 0.17
30 0.18
31 0.19
32 0.21
33 0.25
34 0.23
35 0.26
36 0.31
37 0.33
38 0.37
39 0.45
40 0.44
41 0.5
42 0.59
43 0.65
44 0.68
45 0.75
46 0.8
47 0.82