Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319D932

Protein Details
Accession A0A319D932    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
69-95SSSTGPPKLNKKKPEPKPVKQQPSPSPHydrophilic
135-158MDGTQVEKPRRQRRQRAQPQGGGAHydrophilic
NLS Segment(s)
PositionSequence
60-89KKEKPPAEASSSTGPPKLNKKKPEPKPVKQ
Subcellular Location(s) nucl 20.5, cyto_nucl 13.833, cyto 4, cyto_pero 2.999
Family & Domain DBs
Amino Acid Sequences MSQADSNSTNPTNPSQDDTNTNPNLDQPQETQPQEQQEDTQPQPQQEENQEQELKDPEPKKEKPPAEASSSTGPPKLNKKKPEPKPVKQQPSPSPQPQKEPSPPEQRDPQSRHRRSQPPQNLHTREDPEEEEEAMDGTQVEKPRRQRRQRAQPQGGGAGGPLGDLPGVGQATDLVQNTAGNALNGVTGSAGKAVGGVLGGGQQDKEDGRDEQLRLRLDLNLDIEVQLKAKIHGDLTLGLLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.32
4 0.37
5 0.4
6 0.44
7 0.41
8 0.4
9 0.36
10 0.35
11 0.36
12 0.33
13 0.3
14 0.24
15 0.29
16 0.36
17 0.37
18 0.38
19 0.37
20 0.41
21 0.41
22 0.38
23 0.34
24 0.34
25 0.38
26 0.37
27 0.4
28 0.37
29 0.35
30 0.37
31 0.36
32 0.35
33 0.34
34 0.4
35 0.36
36 0.4
37 0.4
38 0.37
39 0.38
40 0.36
41 0.31
42 0.31
43 0.31
44 0.31
45 0.38
46 0.41
47 0.46
48 0.53
49 0.55
50 0.53
51 0.59
52 0.56
53 0.54
54 0.52
55 0.47
56 0.42
57 0.42
58 0.37
59 0.31
60 0.29
61 0.26
62 0.35
63 0.43
64 0.46
65 0.52
66 0.62
67 0.7
68 0.78
69 0.85
70 0.85
71 0.83
72 0.86
73 0.88
74 0.87
75 0.82
76 0.8
77 0.77
78 0.76
79 0.74
80 0.72
81 0.71
82 0.63
83 0.65
84 0.61
85 0.6
86 0.58
87 0.57
88 0.56
89 0.57
90 0.57
91 0.54
92 0.57
93 0.55
94 0.56
95 0.56
96 0.59
97 0.6
98 0.63
99 0.64
100 0.66
101 0.71
102 0.67
103 0.72
104 0.71
105 0.68
106 0.68
107 0.72
108 0.67
109 0.6
110 0.59
111 0.52
112 0.43
113 0.38
114 0.33
115 0.25
116 0.22
117 0.2
118 0.15
119 0.12
120 0.1
121 0.08
122 0.07
123 0.04
124 0.04
125 0.06
126 0.1
127 0.12
128 0.16
129 0.26
130 0.36
131 0.47
132 0.56
133 0.65
134 0.72
135 0.82
136 0.89
137 0.91
138 0.88
139 0.81
140 0.74
141 0.64
142 0.53
143 0.42
144 0.3
145 0.19
146 0.12
147 0.08
148 0.05
149 0.03
150 0.03
151 0.03
152 0.03
153 0.04
154 0.04
155 0.04
156 0.04
157 0.05
158 0.06
159 0.08
160 0.08
161 0.07
162 0.07
163 0.08
164 0.08
165 0.1
166 0.09
167 0.07
168 0.07
169 0.06
170 0.06
171 0.06
172 0.06
173 0.04
174 0.04
175 0.05
176 0.05
177 0.05
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.03
185 0.05
186 0.06
187 0.06
188 0.06
189 0.06
190 0.08
191 0.08
192 0.1
193 0.11
194 0.12
195 0.17
196 0.23
197 0.24
198 0.29
199 0.35
200 0.35
201 0.33
202 0.34
203 0.31
204 0.27
205 0.3
206 0.26
207 0.21
208 0.2
209 0.19
210 0.19
211 0.17
212 0.16
213 0.14
214 0.13
215 0.13
216 0.15
217 0.16
218 0.15
219 0.17
220 0.18
221 0.17