Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8NWN4

Protein Details
Accession A8NWN4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
42-61DYWNKGKQWKDIRHKYVQEEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, golg 2, mito 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
KEGG cci:CC1G_00077  -  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MAIGNALYNTIFKRNSVFVSTVFVGAFAFGIGFDTGVSKFFDYWNKGKQWKDIRHKYVQEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.24
4 0.23
5 0.19
6 0.23
7 0.23
8 0.2
9 0.17
10 0.15
11 0.11
12 0.1
13 0.09
14 0.04
15 0.03
16 0.02
17 0.03
18 0.03
19 0.03
20 0.03
21 0.04
22 0.04
23 0.06
24 0.07
25 0.06
26 0.07
27 0.09
28 0.15
29 0.2
30 0.24
31 0.3
32 0.36
33 0.42
34 0.44
35 0.52
36 0.56
37 0.62
38 0.68
39 0.72
40 0.74
41 0.78