Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319DM84

Protein Details
Accession A0A319DM84    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MTVTKQPRRHACNRCRTHKPRCERSRGNLDVHydrophilic
52-74RLRSIHTKHRYSRKSYEKQSNIDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MTVTKQPRRHACNRCRTHKPRCERSRGNLDVCDRCVRSRLTCVSSPTLPMGRLRSIHTKHRYSRKSYEKQSNID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.86
4 0.87
5 0.85
6 0.85
7 0.85
8 0.85
9 0.86
10 0.82
11 0.82
12 0.81
13 0.77
14 0.7
15 0.63
16 0.59
17 0.51
18 0.47
19 0.43
20 0.33
21 0.28
22 0.28
23 0.25
24 0.21
25 0.24
26 0.25
27 0.25
28 0.27
29 0.3
30 0.3
31 0.29
32 0.29
33 0.26
34 0.24
35 0.2
36 0.2
37 0.21
38 0.2
39 0.21
40 0.24
41 0.31
42 0.34
43 0.43
44 0.49
45 0.54
46 0.6
47 0.69
48 0.72
49 0.71
50 0.77
51 0.78
52 0.8
53 0.82
54 0.84