Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319CS32

Protein Details
Accession A0A319CS32    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-32SLSAAEKKRLRDRRAQQALRNKKLKHHydrophilic
NLS Segment(s)
PositionSequence
13-28KKRLRDRRAQQALRNK
Subcellular Location(s) nucl 24, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Amino Acid Sequences MSQSPSSLSAAEKKRLRDRRAQQALRNKKLKHTTQLEDKVAHCERYHDDSTAQHLLQVIEGLQQQNELLRQRQDSLKALVGSWDGDTIITTTSSATEPTLPFPQPQLPPPQSPIHTLIPKPIPSSTTTITTTPTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.63
3 0.66
4 0.68
5 0.71
6 0.74
7 0.81
8 0.8
9 0.78
10 0.8
11 0.85
12 0.84
13 0.83
14 0.73
15 0.71
16 0.73
17 0.71
18 0.69
19 0.66
20 0.63
21 0.65
22 0.71
23 0.65
24 0.58
25 0.53
26 0.51
27 0.45
28 0.41
29 0.3
30 0.26
31 0.27
32 0.3
33 0.31
34 0.25
35 0.24
36 0.23
37 0.28
38 0.28
39 0.24
40 0.18
41 0.17
42 0.16
43 0.15
44 0.14
45 0.08
46 0.07
47 0.08
48 0.08
49 0.07
50 0.07
51 0.06
52 0.07
53 0.09
54 0.09
55 0.1
56 0.11
57 0.12
58 0.15
59 0.17
60 0.19
61 0.19
62 0.2
63 0.21
64 0.2
65 0.19
66 0.18
67 0.16
68 0.14
69 0.11
70 0.09
71 0.06
72 0.06
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06
81 0.07
82 0.07
83 0.09
84 0.1
85 0.14
86 0.17
87 0.17
88 0.18
89 0.2
90 0.25
91 0.25
92 0.28
93 0.34
94 0.35
95 0.37
96 0.41
97 0.44
98 0.4
99 0.42
100 0.43
101 0.41
102 0.43
103 0.4
104 0.43
105 0.44
106 0.44
107 0.42
108 0.39
109 0.33
110 0.31
111 0.36
112 0.31
113 0.3
114 0.3
115 0.29