Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319DU49

Protein Details
Accession A0A319DU49    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
194-222TSSKASAPLPRHRRRSQNKERRSNSVDRPHydrophilic
NLS Segment(s)
PositionSequence
203-215PRHRRRSQNKERR
Subcellular Location(s) mito 9, plas 4, nucl 3.5, cyto_nucl 3.5, extr 3, E.R. 3, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MNCPGCRKGPRSGSAAPRPGIPPCGRQMRLLRLIVALSPALTPAIIALDVDSSRVTFPPPDRPPLSAVGIHPALGDEPGHRPVPSIPSAHDLFAAAGRRETGDGYYVVSKGTCKTSLTSVDGGPSSDCFVGSPMLPGLLSIPDPGSSRKLITTSIRRTRPPFKVGIETNEQRWKLGMIEPSNEIALPLSRPMSTSSKASAPLPRHRRRSQNKERRSNSVDRPPASSARSVGRWC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.6
4 0.55
5 0.53
6 0.48
7 0.48
8 0.42
9 0.37
10 0.38
11 0.47
12 0.45
13 0.49
14 0.54
15 0.55
16 0.59
17 0.55
18 0.48
19 0.4
20 0.39
21 0.32
22 0.27
23 0.18
24 0.11
25 0.09
26 0.08
27 0.07
28 0.07
29 0.06
30 0.04
31 0.05
32 0.05
33 0.04
34 0.04
35 0.06
36 0.06
37 0.07
38 0.07
39 0.07
40 0.08
41 0.08
42 0.09
43 0.12
44 0.15
45 0.24
46 0.28
47 0.35
48 0.36
49 0.37
50 0.39
51 0.38
52 0.38
53 0.3
54 0.27
55 0.25
56 0.23
57 0.21
58 0.18
59 0.14
60 0.12
61 0.1
62 0.1
63 0.06
64 0.09
65 0.12
66 0.13
67 0.12
68 0.13
69 0.14
70 0.19
71 0.2
72 0.18
73 0.17
74 0.21
75 0.22
76 0.21
77 0.19
78 0.15
79 0.13
80 0.14
81 0.15
82 0.11
83 0.1
84 0.1
85 0.1
86 0.1
87 0.1
88 0.08
89 0.07
90 0.07
91 0.08
92 0.09
93 0.09
94 0.08
95 0.08
96 0.08
97 0.08
98 0.1
99 0.1
100 0.09
101 0.1
102 0.13
103 0.15
104 0.17
105 0.17
106 0.15
107 0.15
108 0.15
109 0.14
110 0.12
111 0.09
112 0.08
113 0.07
114 0.07
115 0.06
116 0.06
117 0.07
118 0.06
119 0.07
120 0.05
121 0.06
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.06
130 0.08
131 0.09
132 0.11
133 0.12
134 0.12
135 0.13
136 0.14
137 0.16
138 0.22
139 0.29
140 0.37
141 0.44
142 0.48
143 0.52
144 0.57
145 0.63
146 0.62
147 0.58
148 0.53
149 0.48
150 0.51
151 0.49
152 0.48
153 0.47
154 0.42
155 0.44
156 0.46
157 0.42
158 0.35
159 0.33
160 0.29
161 0.22
162 0.25
163 0.26
164 0.21
165 0.23
166 0.24
167 0.25
168 0.24
169 0.22
170 0.18
171 0.12
172 0.11
173 0.09
174 0.1
175 0.1
176 0.1
177 0.11
178 0.15
179 0.2
180 0.21
181 0.23
182 0.24
183 0.25
184 0.27
185 0.3
186 0.32
187 0.34
188 0.43
189 0.51
190 0.57
191 0.64
192 0.7
193 0.78
194 0.82
195 0.87
196 0.88
197 0.88
198 0.89
199 0.91
200 0.89
201 0.87
202 0.83
203 0.81
204 0.79
205 0.79
206 0.77
207 0.67
208 0.67
209 0.62
210 0.59
211 0.53
212 0.47
213 0.39
214 0.37