Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319DU49

Protein Details
Accession A0A319DU49   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
194-222TSSKASAPLPRHRRRSQNKERRSNSVDRPHydrophilic
NLS Segment(s)
PositionSequence
203-215PRHRRRSQNKERR
Subcellular Location(s) mito 9, plas 4, nucl 3.5, cyto_nucl 3.5, extr 3, E.R. 3, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MNCPGCRKGPRSGSAAPRPGIPPCGRQMRLLRLIVALSPALTPAIIALDVDSSRVTFPPPDRPPLSAVGIHPALGDEPGHRPVPSIPSAHDLFAAAGRRETGDGYYVVSKGTCKTSLTSVDGGPSSDCFVGSPMLPGLLSIPDPGSSRKLITTSIRRTRPPFKVGIETNEQRWKLGMIEPSNEIALPLSRPMSTSSKASAPLPRHRRRSQNKERRSNSVDRPPASSARSVGRWC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.6
4 0.55
5 0.53
6 0.48
7 0.48
8 0.42
9 0.37
10 0.38
11 0.47
12 0.45
13 0.49
14 0.54
15 0.55
16 0.59
17 0.55
18 0.48
19 0.4
20 0.39
21 0.32
22 0.27
23 0.18
24 0.11
25 0.09
26 0.08
27 0.07
28 0.07
29 0.06
30 0.04
31 0.05
32 0.05
33 0.04
34 0.04
35 0.06
36 0.06
37 0.07
38 0.07
39 0.07
40 0.08
41 0.08
42 0.09
43 0.12
44 0.15
45 0.24
46 0.28
47 0.35
48 0.36
49 0.37
50 0.39
51 0.38
52 0.38
53 0.3
54 0.27
55 0.25
56 0.23
57 0.21
58 0.18
59 0.14
60 0.12
61 0.1
62 0.1
63 0.06
64 0.09
65 0.12
66 0.13
67 0.12
68 0.13
69 0.14
70 0.19
71 0.2
72 0.18
73 0.17
74 0.21
75 0.22
76 0.21
77 0.19
78 0.15
79 0.13
80 0.14
81 0.15
82 0.11
83 0.1
84 0.1
85 0.1
86 0.1
87 0.1
88 0.08
89 0.07
90 0.07
91 0.08
92 0.09
93 0.09
94 0.08
95 0.08
96 0.08
97 0.08
98 0.1
99 0.1
100 0.09
101 0.1
102 0.13
103 0.15
104 0.17
105 0.17
106 0.15
107 0.15
108 0.15
109 0.14
110 0.12
111 0.09
112 0.08
113 0.07
114 0.07
115 0.06
116 0.06
117 0.07
118 0.06
119 0.07
120 0.05
121 0.06
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.06
130 0.08
131 0.09
132 0.11
133 0.12
134 0.12
135 0.13
136 0.14
137 0.16
138 0.22
139 0.29
140 0.37
141 0.44
142 0.48
143 0.52
144 0.57
145 0.63
146 0.62
147 0.58
148 0.53
149 0.48
150 0.51
151 0.49
152 0.48
153 0.47
154 0.42
155 0.44
156 0.46
157 0.42
158 0.35
159 0.33
160 0.29
161 0.22
162 0.25
163 0.26
164 0.21
165 0.23
166 0.24
167 0.25
168 0.24
169 0.22
170 0.18
171 0.12
172 0.11
173 0.09
174 0.1
175 0.1
176 0.1
177 0.11
178 0.15
179 0.2
180 0.21
181 0.23
182 0.24
183 0.25
184 0.27
185 0.3
186 0.32
187 0.34
188 0.43
189 0.51
190 0.57
191 0.64
192 0.7
193 0.78
194 0.82
195 0.87
196 0.88
197 0.88
198 0.89
199 0.91
200 0.89
201 0.87
202 0.83
203 0.81
204 0.79
205 0.79
206 0.77
207 0.67
208 0.67
209 0.62
210 0.59
211 0.53
212 0.47
213 0.39
214 0.37