Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319CZM2

Protein Details
Accession A0A319CZM2    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAGPRRGTKPKTNKHKHPTKQNSSESIKHydrophilic
NLS Segment(s)
PositionSequence
6-16RGTKPKTNKHK
Subcellular Location(s) mito 15, cyto 4.5, cyto_nucl 4.5, nucl 3.5, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAGPRRGTKPKTNKHKHPTKQNSSESIKMQENVAIAVIIIVLFLLLAIAGFAIHRMKNRVDYGKKPAVDEESGEEAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.92
3 0.9
4 0.91
5 0.91
6 0.9
7 0.9
8 0.84
9 0.81
10 0.76
11 0.71
12 0.62
13 0.56
14 0.47
15 0.38
16 0.32
17 0.26
18 0.2
19 0.16
20 0.13
21 0.08
22 0.06
23 0.05
24 0.05
25 0.03
26 0.02
27 0.02
28 0.02
29 0.01
30 0.01
31 0.01
32 0.01
33 0.01
34 0.01
35 0.01
36 0.02
37 0.02
38 0.03
39 0.05
40 0.07
41 0.09
42 0.12
43 0.14
44 0.2
45 0.26
46 0.35
47 0.39
48 0.44
49 0.51
50 0.56
51 0.56
52 0.52
53 0.5
54 0.45
55 0.4
56 0.36
57 0.33