Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319DKZ8

Protein Details
Accession A0A319DKZ8    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
38-64IYLNYVSPKKKKKPKKKTGMQSHHSASHydrophilic
NLS Segment(s)
PositionSequence
45-54PKKKKKPKKK
Subcellular Location(s) mito 17, mito_nucl 11.333, cyto_mito 10.333, nucl 4.5, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGRSWVFGVSGPTEPKLNSAVPVQISVPVVPLTHALSIYLNYVSPKKKKKPKKKTGMQSHHSASVITKAHIPRLFANHNHNRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.19
5 0.17
6 0.16
7 0.18
8 0.17
9 0.18
10 0.16
11 0.15
12 0.16
13 0.14
14 0.13
15 0.1
16 0.09
17 0.09
18 0.1
19 0.09
20 0.08
21 0.08
22 0.07
23 0.07
24 0.08
25 0.08
26 0.07
27 0.06
28 0.07
29 0.1
30 0.15
31 0.21
32 0.3
33 0.39
34 0.48
35 0.59
36 0.7
37 0.78
38 0.85
39 0.89
40 0.91
41 0.92
42 0.94
43 0.93
44 0.86
45 0.82
46 0.74
47 0.66
48 0.56
49 0.45
50 0.35
51 0.31
52 0.28
53 0.21
54 0.24
55 0.21
56 0.29
57 0.3
58 0.32
59 0.3
60 0.37
61 0.42
62 0.42
63 0.52