Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319CQ09

Protein Details
Accession A0A319CQ09   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
380-412QRYSHMPEIRRIKRQRHVPKPIKKAREIKREELBasic
414-446ALKRREENVRKHTKKENLPKRRSEREKMILAKEBasic
NLS Segment(s)
PositionSequence
389-440RRIKRQRHVPKPIKKAREIKREELMALKRREENVRKHTKKENLPKRRSEREK
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR020472  G-protein_beta_WD-40_rep  
IPR007287  Sof1  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR036322  WD40_repeat_dom_sf  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF04158  Sof1  
PF00400  WD40  
PROSITE View protein in PROSITE  
PS50082  WD_REPEATS_2  
PS50294  WD_REPEATS_REGION  
CDD cd00200  WD40  
Amino Acid Sequences MKIKALSRPTSSQQAPGTSVVRQPRNLDPAQHPFERAREYTRALNATKLERLFASPFLGQMGDGHVDGVYTMAKDPGSLQRFASGSGDGVVKVWDLTTQGEVWNTQAHDNIVKGVCWTPDRKLLSCASDKTVKLFDPYNSEPDTPPLATYLGGGAFTSLTHHRDLPYFAAASSQISIYDLSRPSSTPSQTLHWPTNVDTITSIAFNQTETSILGSTGIDRSIIMYDLRTSSPLHKMTLRLASNAISWNPMEAFNFAVANEDHNVYLFDMRKMDRALNVLKDHVAAVMDVDFSPTGQELVTASYDRTIRLWNRATGHSRDIYHTQRMQRVFSTKFTPDNKYVLSGSDDGNIRLWRSNASDRSGVKSARQRAKLEYDQALIQRYSHMPEIRRIKRQRHVPKPIKKAREIKREELMALKRREENVRKHTKKENLPKRRSEREKMILAKEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.45
3 0.43
4 0.4
5 0.33
6 0.38
7 0.4
8 0.41
9 0.41
10 0.43
11 0.46
12 0.52
13 0.52
14 0.52
15 0.51
16 0.55
17 0.57
18 0.55
19 0.5
20 0.46
21 0.49
22 0.48
23 0.43
24 0.4
25 0.39
26 0.41
27 0.44
28 0.47
29 0.48
30 0.42
31 0.44
32 0.43
33 0.42
34 0.43
35 0.38
36 0.33
37 0.28
38 0.31
39 0.28
40 0.26
41 0.25
42 0.2
43 0.19
44 0.19
45 0.18
46 0.14
47 0.12
48 0.13
49 0.11
50 0.1
51 0.1
52 0.09
53 0.09
54 0.09
55 0.09
56 0.06
57 0.06
58 0.06
59 0.07
60 0.07
61 0.08
62 0.11
63 0.19
64 0.22
65 0.23
66 0.23
67 0.26
68 0.27
69 0.28
70 0.26
71 0.18
72 0.14
73 0.15
74 0.15
75 0.1
76 0.1
77 0.09
78 0.08
79 0.07
80 0.07
81 0.06
82 0.07
83 0.08
84 0.09
85 0.1
86 0.1
87 0.11
88 0.12
89 0.12
90 0.14
91 0.14
92 0.14
93 0.14
94 0.15
95 0.16
96 0.16
97 0.19
98 0.16
99 0.15
100 0.16
101 0.16
102 0.17
103 0.19
104 0.21
105 0.2
106 0.27
107 0.31
108 0.31
109 0.33
110 0.34
111 0.36
112 0.38
113 0.37
114 0.34
115 0.36
116 0.34
117 0.34
118 0.33
119 0.28
120 0.26
121 0.27
122 0.24
123 0.26
124 0.28
125 0.29
126 0.29
127 0.3
128 0.28
129 0.28
130 0.29
131 0.21
132 0.19
133 0.15
134 0.13
135 0.12
136 0.12
137 0.1
138 0.07
139 0.07
140 0.06
141 0.05
142 0.05
143 0.05
144 0.07
145 0.08
146 0.1
147 0.11
148 0.12
149 0.13
150 0.15
151 0.17
152 0.16
153 0.16
154 0.14
155 0.13
156 0.13
157 0.12
158 0.11
159 0.1
160 0.08
161 0.06
162 0.07
163 0.07
164 0.07
165 0.11
166 0.11
167 0.12
168 0.12
169 0.13
170 0.16
171 0.2
172 0.21
173 0.2
174 0.21
175 0.22
176 0.26
177 0.3
178 0.28
179 0.25
180 0.25
181 0.23
182 0.27
183 0.24
184 0.19
185 0.15
186 0.14
187 0.13
188 0.12
189 0.11
190 0.06
191 0.06
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.06
198 0.06
199 0.06
200 0.06
201 0.05
202 0.06
203 0.06
204 0.06
205 0.05
206 0.04
207 0.05
208 0.05
209 0.06
210 0.05
211 0.05
212 0.06
213 0.08
214 0.08
215 0.08
216 0.09
217 0.11
218 0.17
219 0.18
220 0.19
221 0.19
222 0.2
223 0.23
224 0.29
225 0.27
226 0.22
227 0.21
228 0.2
229 0.2
230 0.2
231 0.17
232 0.11
233 0.1
234 0.1
235 0.09
236 0.09
237 0.09
238 0.08
239 0.08
240 0.07
241 0.08
242 0.07
243 0.08
244 0.08
245 0.08
246 0.09
247 0.09
248 0.08
249 0.08
250 0.09
251 0.07
252 0.11
253 0.11
254 0.11
255 0.13
256 0.13
257 0.16
258 0.17
259 0.18
260 0.16
261 0.18
262 0.2
263 0.23
264 0.23
265 0.21
266 0.2
267 0.19
268 0.18
269 0.14
270 0.12
271 0.07
272 0.06
273 0.06
274 0.06
275 0.05
276 0.06
277 0.05
278 0.05
279 0.06
280 0.05
281 0.05
282 0.04
283 0.05
284 0.04
285 0.06
286 0.07
287 0.08
288 0.08
289 0.1
290 0.11
291 0.11
292 0.12
293 0.16
294 0.18
295 0.25
296 0.28
297 0.3
298 0.33
299 0.39
300 0.43
301 0.41
302 0.43
303 0.39
304 0.37
305 0.36
306 0.39
307 0.38
308 0.39
309 0.41
310 0.42
311 0.44
312 0.45
313 0.44
314 0.42
315 0.44
316 0.39
317 0.37
318 0.38
319 0.34
320 0.4
321 0.42
322 0.44
323 0.41
324 0.42
325 0.39
326 0.37
327 0.34
328 0.28
329 0.27
330 0.23
331 0.2
332 0.21
333 0.21
334 0.19
335 0.21
336 0.21
337 0.19
338 0.19
339 0.19
340 0.17
341 0.22
342 0.3
343 0.3
344 0.34
345 0.38
346 0.37
347 0.43
348 0.45
349 0.41
350 0.4
351 0.44
352 0.5
353 0.53
354 0.58
355 0.54
356 0.55
357 0.63
358 0.62
359 0.6
360 0.54
361 0.47
362 0.44
363 0.43
364 0.41
365 0.32
366 0.26
367 0.24
368 0.22
369 0.23
370 0.26
371 0.29
372 0.28
373 0.36
374 0.47
375 0.5
376 0.59
377 0.64
378 0.68
379 0.72
380 0.8
381 0.83
382 0.83
383 0.87
384 0.87
385 0.89
386 0.91
387 0.92
388 0.9
389 0.88
390 0.87
391 0.86
392 0.87
393 0.84
394 0.8
395 0.78
396 0.72
397 0.64
398 0.63
399 0.61
400 0.59
401 0.56
402 0.53
403 0.51
404 0.53
405 0.61
406 0.61
407 0.63
408 0.65
409 0.72
410 0.73
411 0.75
412 0.8
413 0.79
414 0.81
415 0.82
416 0.83
417 0.82
418 0.86
419 0.9
420 0.9
421 0.91
422 0.9
423 0.88
424 0.88
425 0.85
426 0.85
427 0.82