Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319E8C2

Protein Details
Accession A0A319E8C2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
141-162GDAPPPKDGNKPQKPQKPTKGNHydrophilic
NLS Segment(s)
PositionSequence
86-131KPPKEGPPPTNLPKPAKGANDSNKRDDNGKPPKEGPPPTDLPKPTK
138-161SKRGDAPPPKDGNKPQKPQKPTKG
Subcellular Location(s) extr 21, E.R. 3, golg 2
Family & Domain DBs
Amino Acid Sequences MKFSAVLSTLMVAGLVAAAPPAERPAGLQETTIRQPPPTDAPLPKLNDNDNNKRDDNETPPKKGLPPTDLPTPPKDEHNQKRDNQKPPKEGPPPTNLPKPAKGANDSNKRDDNGKPPKEGPPPTDLPKPTKGDNNDNSKRGDAPPPKDGNKPQKPQKPTKGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.05
9 0.06
10 0.06
11 0.07
12 0.12
13 0.17
14 0.17
15 0.18
16 0.19
17 0.24
18 0.27
19 0.3
20 0.25
21 0.22
22 0.23
23 0.25
24 0.28
25 0.27
26 0.3
27 0.28
28 0.33
29 0.39
30 0.41
31 0.41
32 0.38
33 0.37
34 0.4
35 0.46
36 0.51
37 0.47
38 0.49
39 0.46
40 0.45
41 0.44
42 0.39
43 0.39
44 0.4
45 0.42
46 0.41
47 0.42
48 0.42
49 0.42
50 0.42
51 0.38
52 0.33
53 0.33
54 0.33
55 0.39
56 0.4
57 0.4
58 0.38
59 0.4
60 0.35
61 0.34
62 0.35
63 0.38
64 0.44
65 0.5
66 0.54
67 0.53
68 0.63
69 0.67
70 0.72
71 0.71
72 0.7
73 0.69
74 0.67
75 0.71
76 0.68
77 0.64
78 0.58
79 0.55
80 0.54
81 0.52
82 0.53
83 0.5
84 0.46
85 0.45
86 0.45
87 0.43
88 0.39
89 0.38
90 0.4
91 0.44
92 0.51
93 0.51
94 0.53
95 0.51
96 0.49
97 0.48
98 0.44
99 0.44
100 0.45
101 0.45
102 0.44
103 0.44
104 0.5
105 0.56
106 0.56
107 0.49
108 0.46
109 0.47
110 0.48
111 0.53
112 0.49
113 0.46
114 0.5
115 0.5
116 0.47
117 0.49
118 0.5
119 0.53
120 0.57
121 0.62
122 0.62
123 0.61
124 0.6
125 0.54
126 0.51
127 0.44
128 0.47
129 0.45
130 0.43
131 0.5
132 0.55
133 0.57
134 0.62
135 0.69
136 0.7
137 0.71
138 0.75
139 0.76
140 0.78
141 0.84
142 0.87