Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319DJD2

Protein Details
Accession A0A319DJD2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
83-103IEPSRQRRYLLRKREKFRHGIBasic
223-244GGERRRAEVRAKKRSEERKKEMBasic
NLS Segment(s)
PositionSequence
224-244GERRRAEVRAKKRSEERKKEM
Subcellular Location(s) mito 24.5, mito_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039603  Fyv4  
IPR019083  IGR_protein_motif  
IPR013761  SAM/pointed_sf  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF09597  IGR  
Amino Acid Sequences MAMRNSHRLSLRAMGPFKISRQFLRNFHKDTRAPSAPSPTPFVPDVQTFLSLIGRGMSKYASKLPSWEKLFSMSSTELRELGIEPSRQRRYLLRKREKFRHGIYGPGGDLENVVDGVAQLRIVEVPFELKDSTLGKDVPRQLTASATLTPGMRRVVVNIPPDATDYTYDPSKPLKKFAHMKINNGSIIQGPFLQPLKGSNGRAALIKAQEGMWEDKLGHKVDGGERRRAEVRAKKRSEERKKEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.41
4 0.4
5 0.41
6 0.39
7 0.36
8 0.41
9 0.47
10 0.51
11 0.58
12 0.63
13 0.61
14 0.64
15 0.68
16 0.64
17 0.62
18 0.62
19 0.58
20 0.54
21 0.51
22 0.54
23 0.49
24 0.48
25 0.48
26 0.39
27 0.37
28 0.34
29 0.32
30 0.27
31 0.24
32 0.24
33 0.2
34 0.2
35 0.16
36 0.16
37 0.16
38 0.12
39 0.11
40 0.1
41 0.09
42 0.08
43 0.09
44 0.1
45 0.1
46 0.12
47 0.18
48 0.19
49 0.19
50 0.24
51 0.28
52 0.35
53 0.38
54 0.37
55 0.32
56 0.33
57 0.34
58 0.29
59 0.29
60 0.22
61 0.2
62 0.21
63 0.21
64 0.17
65 0.16
66 0.16
67 0.13
68 0.13
69 0.15
70 0.15
71 0.17
72 0.26
73 0.29
74 0.3
75 0.3
76 0.35
77 0.42
78 0.5
79 0.58
80 0.61
81 0.67
82 0.74
83 0.82
84 0.81
85 0.77
86 0.71
87 0.7
88 0.59
89 0.54
90 0.48
91 0.4
92 0.34
93 0.27
94 0.23
95 0.13
96 0.12
97 0.08
98 0.06
99 0.04
100 0.04
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.04
111 0.03
112 0.04
113 0.05
114 0.06
115 0.06
116 0.06
117 0.08
118 0.09
119 0.1
120 0.11
121 0.12
122 0.11
123 0.16
124 0.21
125 0.21
126 0.21
127 0.2
128 0.19
129 0.19
130 0.2
131 0.17
132 0.13
133 0.11
134 0.12
135 0.11
136 0.11
137 0.12
138 0.11
139 0.1
140 0.1
141 0.12
142 0.16
143 0.21
144 0.23
145 0.22
146 0.22
147 0.21
148 0.22
149 0.2
150 0.16
151 0.13
152 0.12
153 0.14
154 0.15
155 0.14
156 0.14
157 0.2
158 0.27
159 0.27
160 0.34
161 0.35
162 0.41
163 0.5
164 0.57
165 0.62
166 0.57
167 0.62
168 0.6
169 0.61
170 0.53
171 0.44
172 0.37
173 0.28
174 0.26
175 0.21
176 0.15
177 0.11
178 0.14
179 0.15
180 0.14
181 0.12
182 0.13
183 0.2
184 0.25
185 0.25
186 0.25
187 0.26
188 0.27
189 0.28
190 0.28
191 0.25
192 0.21
193 0.2
194 0.18
195 0.16
196 0.17
197 0.18
198 0.21
199 0.18
200 0.17
201 0.17
202 0.21
203 0.25
204 0.25
205 0.22
206 0.2
207 0.22
208 0.28
209 0.38
210 0.38
211 0.42
212 0.41
213 0.46
214 0.48
215 0.48
216 0.51
217 0.51
218 0.58
219 0.6
220 0.65
221 0.68
222 0.75
223 0.83
224 0.84