Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319CRR6

Protein Details
Accession A0A319CRR6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-71AGTSLRNRRRRGRFFRRDPRLGCBasic
NLS Segment(s)
PositionSequence
55-64NRRRRGRFFR
Subcellular Location(s) extr 13, mito 9.5, cyto_mito 6, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MGTTGTTLAFTRTTVGFLGLRTLCLLRSEAFSIRIWNDPPVNWPRGLQAGTSLRNRRRRGRFFRRDPRLGCVGRLVGLKSGLEQSVSTGAPPRHRFGFPARVLERSSDQVLLVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.13
4 0.12
5 0.18
6 0.16
7 0.16
8 0.16
9 0.16
10 0.14
11 0.15
12 0.16
13 0.11
14 0.13
15 0.16
16 0.16
17 0.18
18 0.18
19 0.19
20 0.19
21 0.21
22 0.2
23 0.2
24 0.2
25 0.18
26 0.23
27 0.26
28 0.27
29 0.24
30 0.23
31 0.22
32 0.23
33 0.24
34 0.18
35 0.18
36 0.2
37 0.23
38 0.29
39 0.34
40 0.38
41 0.46
42 0.51
43 0.55
44 0.6
45 0.67
46 0.72
47 0.76
48 0.8
49 0.82
50 0.88
51 0.88
52 0.85
53 0.77
54 0.71
55 0.68
56 0.58
57 0.48
58 0.39
59 0.31
60 0.26
61 0.25
62 0.2
63 0.13
64 0.14
65 0.13
66 0.11
67 0.12
68 0.1
69 0.1
70 0.09
71 0.09
72 0.11
73 0.11
74 0.11
75 0.15
76 0.17
77 0.25
78 0.29
79 0.31
80 0.33
81 0.34
82 0.37
83 0.39
84 0.47
85 0.41
86 0.48
87 0.46
88 0.45
89 0.46
90 0.46
91 0.42
92 0.36
93 0.35
94 0.26