Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319EMS1

Protein Details
Accession A0A319EMS1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
2-22MICSSCGRLKKKRKALMGAWFHydrophilic
NLS Segment(s)
PositionSequence
12-14KKR
Subcellular Location(s) mito 14, mito_nucl 11.833, cyto_mito 8.833, nucl 8.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MMICSSCGRLKKKRKALMGAWFASHSNSCFFFFSFSFFFPFSPFGPIFFFTAWRDNNTNNKDNNNNQNNTGRGTRRLSLGAVRKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.8
4 0.8
5 0.77
6 0.67
7 0.58
8 0.5
9 0.42
10 0.36
11 0.29
12 0.2
13 0.14
14 0.14
15 0.14
16 0.14
17 0.14
18 0.15
19 0.14
20 0.16
21 0.15
22 0.14
23 0.15
24 0.14
25 0.14
26 0.13
27 0.15
28 0.12
29 0.15
30 0.14
31 0.13
32 0.14
33 0.15
34 0.15
35 0.13
36 0.14
37 0.12
38 0.18
39 0.18
40 0.2
41 0.21
42 0.24
43 0.33
44 0.37
45 0.42
46 0.39
47 0.43
48 0.46
49 0.51
50 0.58
51 0.58
52 0.54
53 0.52
54 0.55
55 0.51
56 0.49
57 0.48
58 0.41
59 0.38
60 0.41
61 0.39
62 0.37
63 0.37
64 0.35
65 0.37