Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319EL54

Protein Details
Accession A0A319EL54    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
95-115GVVFRRFRSGVRRARNRRTRPBasic
NLS Segment(s)
PositionSequence
99-116RRFRSGVRXRARNRRTRP
Subcellular Location(s) mito 10, nucl 8, cyto 5, extr 4
Family & Domain DBs
Amino Acid Sequences PHPHLLYPPQKPQRPASAPTPATPDSNATETPTETPTARDSPRWSCCLPGTAGYLTTGSAGFAAVVGGGAASARASFPGCRRRRGGFPALGAFGGVVFRRFRSGVRXRARNRRTRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.62
3 0.59
4 0.59
5 0.55
6 0.52
7 0.53
8 0.43
9 0.39
10 0.36
11 0.31
12 0.24
13 0.25
14 0.24
15 0.2
16 0.19
17 0.19
18 0.2
19 0.18
20 0.17
21 0.14
22 0.16
23 0.17
24 0.2
25 0.21
26 0.22
27 0.25
28 0.31
29 0.35
30 0.37
31 0.34
32 0.31
33 0.31
34 0.3
35 0.26
36 0.21
37 0.19
38 0.15
39 0.15
40 0.13
41 0.12
42 0.1
43 0.09
44 0.07
45 0.05
46 0.04
47 0.04
48 0.03
49 0.03
50 0.03
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.03
62 0.04
63 0.07
64 0.13
65 0.24
66 0.28
67 0.33
68 0.38
69 0.42
70 0.48
71 0.53
72 0.55
73 0.49
74 0.49
75 0.47
76 0.44
77 0.39
78 0.32
79 0.24
80 0.16
81 0.13
82 0.1
83 0.09
84 0.09
85 0.1
86 0.13
87 0.14
88 0.18
89 0.25
90 0.34
91 0.42
92 0.52
93 0.63
94 0.7
95 0.8