Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319D262

Protein Details
Accession A0A319D262   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-75IRMSYLKGNMKRRKRRPETTDRIFRLHydrophilic
NLS Segment(s)
PositionSequence
60-65KRRKRR
Subcellular Location(s) mito 11, nucl 7.5, cyto_nucl 7, cyto 5.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPSGSVRAGPRPEGFSRPPHTTTVWTMDAPLCTVSLDPIIQHRILILLVIRMSYLKGNMKRRKRRPETTDRIFRLEANGESGNGTHGTGNTPESDEVVAGLGFQIPLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.45
4 0.47
5 0.46
6 0.44
7 0.43
8 0.4
9 0.4
10 0.37
11 0.34
12 0.28
13 0.27
14 0.25
15 0.24
16 0.2
17 0.17
18 0.11
19 0.09
20 0.09
21 0.08
22 0.07
23 0.07
24 0.06
25 0.09
26 0.11
27 0.11
28 0.11
29 0.1
30 0.09
31 0.09
32 0.09
33 0.07
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.07
42 0.12
43 0.19
44 0.29
45 0.37
46 0.48
47 0.58
48 0.68
49 0.77
50 0.81
51 0.85
52 0.84
53 0.87
54 0.86
55 0.85
56 0.85
57 0.77
58 0.72
59 0.62
60 0.53
61 0.45
62 0.38
63 0.29
64 0.23
65 0.21
66 0.17
67 0.17
68 0.16
69 0.15
70 0.12
71 0.12
72 0.08
73 0.08
74 0.1
75 0.11
76 0.12
77 0.12
78 0.13
79 0.13
80 0.13
81 0.13
82 0.11
83 0.1
84 0.1
85 0.09
86 0.06
87 0.06
88 0.06