Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319DLT3

Protein Details
Accession A0A319DLT3    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-33SPKQQHKSSVEKKSLRQKRDRRRSCLEKKSLEYHydrophilic
NLS Segment(s)
PositionSequence
13-22KSLRQKRDRR
Subcellular Location(s) nucl 15, mito 10, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences SPKQQHKSSVEKKSLRQKRDRRRSCLEKKSLEYSEICGADVCLGIRIRQSGKVFIFSADASGFWPFLSSQPSPYYPPPVERNGKKQLKSGRAWYNLLIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.8
4 0.8
5 0.82
6 0.87
7 0.89
8 0.86
9 0.87
10 0.89
11 0.89
12 0.89
13 0.86
14 0.82
15 0.77
16 0.75
17 0.66
18 0.58
19 0.48
20 0.4
21 0.36
22 0.29
23 0.25
24 0.17
25 0.16
26 0.13
27 0.13
28 0.1
29 0.07
30 0.07
31 0.07
32 0.08
33 0.1
34 0.1
35 0.15
36 0.16
37 0.18
38 0.18
39 0.2
40 0.2
41 0.19
42 0.19
43 0.14
44 0.14
45 0.1
46 0.09
47 0.08
48 0.08
49 0.07
50 0.06
51 0.07
52 0.06
53 0.07
54 0.12
55 0.11
56 0.14
57 0.18
58 0.2
59 0.24
60 0.25
61 0.31
62 0.28
63 0.34
64 0.36
65 0.41
66 0.48
67 0.5
68 0.56
69 0.6
70 0.66
71 0.63
72 0.66
73 0.68
74 0.67
75 0.67
76 0.68
77 0.67
78 0.64
79 0.64