Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319DDA3

Protein Details
Accession A0A319DDA3   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
14-38LWKIPWRMSRPQKARQRERLRAVDRHydrophilic
74-103DKYTIFDKKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
81-95KKEKKYRKGIHKLPK
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MMFKPSSPLLSGLLWKIPWRMSRPQKARQRERLRAVDRVVDTVSAALERNGFQAKAVERWYQEMPREEEMLPKDKYTIFDKKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.21
4 0.23
5 0.26
6 0.29
7 0.38
8 0.45
9 0.55
10 0.62
11 0.69
12 0.74
13 0.8
14 0.85
15 0.85
16 0.86
17 0.84
18 0.85
19 0.85
20 0.79
21 0.74
22 0.65
23 0.6
24 0.5
25 0.43
26 0.34
27 0.24
28 0.2
29 0.15
30 0.13
31 0.07
32 0.07
33 0.05
34 0.05
35 0.06
36 0.07
37 0.08
38 0.08
39 0.07
40 0.1
41 0.11
42 0.13
43 0.15
44 0.16
45 0.15
46 0.19
47 0.21
48 0.21
49 0.24
50 0.26
51 0.26
52 0.26
53 0.28
54 0.25
55 0.27
56 0.27
57 0.3
58 0.26
59 0.23
60 0.22
61 0.21
62 0.24
63 0.26
64 0.32
65 0.31
66 0.39
67 0.47
68 0.55
69 0.64
70 0.7
71 0.71
72 0.73
73 0.79
74 0.81
75 0.84
76 0.85
77 0.86
78 0.85
79 0.89
80 0.88
81 0.88
82 0.83
83 0.8
84 0.8
85 0.8
86 0.8
87 0.77
88 0.79