Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319DKM8

Protein Details
Accession A0A319DKM8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
66-88NSDQNEQQPKRKRGGRKPKDDSDBasic
NLS Segment(s)
PositionSequence
75-84KRKRGGRKPK
Subcellular Location(s) nucl 14.5, mito_nucl 12.166, cyto_nucl 9.333, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences IAKALELFMISLVTKAAREAKDRNSKRVTASHLKQAVVKDEVLDFLADIISKVPDQPASRKHDDDNSDQNEQQPKRKRGGRKPKDDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.15
4 0.17
5 0.21
6 0.26
7 0.35
8 0.46
9 0.5
10 0.56
11 0.54
12 0.54
13 0.53
14 0.54
15 0.52
16 0.5
17 0.5
18 0.5
19 0.48
20 0.46
21 0.45
22 0.41
23 0.37
24 0.28
25 0.25
26 0.17
27 0.14
28 0.14
29 0.11
30 0.1
31 0.06
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.09
42 0.11
43 0.16
44 0.23
45 0.31
46 0.35
47 0.37
48 0.39
49 0.43
50 0.45
51 0.46
52 0.48
53 0.45
54 0.45
55 0.43
56 0.46
57 0.48
58 0.47
59 0.5
60 0.51
61 0.51
62 0.56
63 0.64
64 0.7
65 0.72
66 0.81
67 0.82
68 0.83