Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319CZ93

Protein Details
Accession A0A319CZ93    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
468-490PFPYIFFRYGKRIRKKSRFATKKHydrophilic
NLS Segment(s)
PositionSequence
477-490GKRIRKKSRFATKK
Subcellular Location(s) plas 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR011701  MFS  
IPR020846  MFS_dom  
IPR036259  MFS_trans_sf  
IPR005829  Sugar_transporter_CS  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
Pfam View protein in Pfam  
PF07690  MFS_1  
PROSITE View protein in PROSITE  
PS50850  MFS  
PS00216  SUGAR_TRANSPORT_1  
CDD cd17323  MFS_Tpo1_MDR_like  
Amino Acid Sequences MVRAEPNPEEVDLTPQDQNGEYQDDFEVRWDEADAANPHNMTRKRKWAVVILVSSMSLCVCVTSSLYTTTYSQIMVEFGCSRIVATLGLSFYIAGLGWGPLVMSPLSEFYGRRPIYLVSLPLFVIFLIPCAVARNIQTMLVARLLDGLAGAAFTSVAGATVGDMYSKSTLHFPMLVYTASPFTGASLGPILGGLINSWASWRWSFYFLLIWASLQSVLMMVFVPETYHPVLLRNRACKLRRETGDGRWRAPIEKLDRSVLKTVLRSLYRPFMLLLLEPMCLNLCVLSAIALGVQYLFFGAFGIVYGNAYDFKLWQTGLAFSGLLVGMVLAVAVDPWFRKLYPRFNRSGQDEAADQEPEARLPPAVIGAPLLTIGLFWFGWTAIPSVHWIVPIIGSGLFGAGMIFVFQGVFTFVVDAYPLYAASALGANSFTRSTFAAAFPLFGVAMYHRLGDQWATSLLAFLGLAMAPFPYIFFRYGKRIRKKSRFATKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.25
4 0.23
5 0.23
6 0.2
7 0.23
8 0.19
9 0.19
10 0.2
11 0.2
12 0.19
13 0.21
14 0.2
15 0.14
16 0.15
17 0.14
18 0.14
19 0.14
20 0.2
21 0.2
22 0.2
23 0.23
24 0.23
25 0.23
26 0.31
27 0.36
28 0.38
29 0.44
30 0.52
31 0.54
32 0.59
33 0.62
34 0.62
35 0.63
36 0.62
37 0.56
38 0.48
39 0.43
40 0.38
41 0.33
42 0.25
43 0.17
44 0.1
45 0.07
46 0.05
47 0.05
48 0.06
49 0.07
50 0.09
51 0.1
52 0.12
53 0.14
54 0.15
55 0.16
56 0.17
57 0.17
58 0.15
59 0.14
60 0.12
61 0.12
62 0.11
63 0.12
64 0.11
65 0.11
66 0.11
67 0.11
68 0.11
69 0.1
70 0.11
71 0.08
72 0.08
73 0.09
74 0.09
75 0.09
76 0.09
77 0.08
78 0.07
79 0.07
80 0.06
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.06
89 0.05
90 0.05
91 0.06
92 0.07
93 0.09
94 0.1
95 0.1
96 0.12
97 0.22
98 0.22
99 0.22
100 0.23
101 0.22
102 0.25
103 0.27
104 0.27
105 0.18
106 0.19
107 0.19
108 0.17
109 0.16
110 0.12
111 0.11
112 0.08
113 0.07
114 0.06
115 0.06
116 0.06
117 0.08
118 0.09
119 0.09
120 0.1
121 0.13
122 0.13
123 0.13
124 0.14
125 0.13
126 0.14
127 0.14
128 0.13
129 0.09
130 0.1
131 0.09
132 0.08
133 0.07
134 0.05
135 0.04
136 0.04
137 0.03
138 0.02
139 0.02
140 0.02
141 0.03
142 0.02
143 0.03
144 0.03
145 0.03
146 0.03
147 0.04
148 0.04
149 0.04
150 0.04
151 0.05
152 0.06
153 0.06
154 0.07
155 0.09
156 0.1
157 0.11
158 0.12
159 0.11
160 0.12
161 0.14
162 0.13
163 0.11
164 0.11
165 0.1
166 0.09
167 0.09
168 0.07
169 0.06
170 0.07
171 0.06
172 0.06
173 0.06
174 0.06
175 0.05
176 0.05
177 0.05
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.05
186 0.07
187 0.07
188 0.09
189 0.1
190 0.12
191 0.13
192 0.13
193 0.14
194 0.13
195 0.14
196 0.13
197 0.11
198 0.09
199 0.09
200 0.08
201 0.06
202 0.06
203 0.04
204 0.04
205 0.04
206 0.04
207 0.03
208 0.03
209 0.03
210 0.04
211 0.04
212 0.06
213 0.07
214 0.07
215 0.08
216 0.12
217 0.14
218 0.21
219 0.25
220 0.26
221 0.29
222 0.36
223 0.38
224 0.42
225 0.46
226 0.48
227 0.46
228 0.5
229 0.5
230 0.52
231 0.59
232 0.53
233 0.48
234 0.42
235 0.41
236 0.34
237 0.32
238 0.29
239 0.25
240 0.27
241 0.27
242 0.28
243 0.29
244 0.3
245 0.3
246 0.27
247 0.23
248 0.2
249 0.21
250 0.22
251 0.22
252 0.21
253 0.21
254 0.23
255 0.21
256 0.21
257 0.19
258 0.14
259 0.14
260 0.13
261 0.12
262 0.09
263 0.08
264 0.08
265 0.08
266 0.07
267 0.06
268 0.06
269 0.04
270 0.04
271 0.04
272 0.04
273 0.04
274 0.03
275 0.03
276 0.04
277 0.03
278 0.03
279 0.03
280 0.03
281 0.03
282 0.03
283 0.03
284 0.03
285 0.03
286 0.03
287 0.03
288 0.03
289 0.04
290 0.03
291 0.04
292 0.04
293 0.04
294 0.05
295 0.05
296 0.05
297 0.05
298 0.06
299 0.08
300 0.07
301 0.08
302 0.08
303 0.09
304 0.1
305 0.1
306 0.09
307 0.07
308 0.08
309 0.07
310 0.06
311 0.05
312 0.04
313 0.03
314 0.03
315 0.03
316 0.02
317 0.02
318 0.02
319 0.02
320 0.03
321 0.03
322 0.06
323 0.07
324 0.07
325 0.14
326 0.2
327 0.31
328 0.41
329 0.47
330 0.5
331 0.54
332 0.6
333 0.58
334 0.58
335 0.47
336 0.39
337 0.34
338 0.3
339 0.27
340 0.21
341 0.16
342 0.13
343 0.13
344 0.11
345 0.11
346 0.1
347 0.08
348 0.08
349 0.08
350 0.08
351 0.08
352 0.07
353 0.07
354 0.06
355 0.06
356 0.06
357 0.06
358 0.04
359 0.04
360 0.04
361 0.05
362 0.05
363 0.05
364 0.05
365 0.05
366 0.06
367 0.07
368 0.08
369 0.06
370 0.07
371 0.09
372 0.12
373 0.12
374 0.12
375 0.12
376 0.12
377 0.12
378 0.11
379 0.1
380 0.08
381 0.07
382 0.07
383 0.06
384 0.05
385 0.05
386 0.04
387 0.03
388 0.03
389 0.03
390 0.03
391 0.03
392 0.03
393 0.03
394 0.04
395 0.05
396 0.05
397 0.05
398 0.06
399 0.06
400 0.06
401 0.06
402 0.06
403 0.06
404 0.06
405 0.06
406 0.05
407 0.06
408 0.06
409 0.06
410 0.07
411 0.07
412 0.07
413 0.08
414 0.08
415 0.09
416 0.1
417 0.1
418 0.1
419 0.11
420 0.13
421 0.14
422 0.14
423 0.18
424 0.17
425 0.18
426 0.16
427 0.16
428 0.14
429 0.12
430 0.12
431 0.08
432 0.11
433 0.11
434 0.11
435 0.11
436 0.11
437 0.12
438 0.13
439 0.12
440 0.11
441 0.12
442 0.12
443 0.12
444 0.12
445 0.11
446 0.1
447 0.09
448 0.07
449 0.07
450 0.05
451 0.05
452 0.05
453 0.05
454 0.05
455 0.05
456 0.06
457 0.08
458 0.1
459 0.13
460 0.15
461 0.2
462 0.3
463 0.4
464 0.49
465 0.58
466 0.67
467 0.76
468 0.84
469 0.9
470 0.91