Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319EFL0

Protein Details
Accession A0A319EFL0    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
51-95RSAASLSRSPRRRRSRTRTRSTSRTRSRSPYRDHRGYKRRRDDDYBasic
153-175SDESDRRREKRARTRSRSPYHEVBasic
NLS Segment(s)
PositionSequence
57-91SRSPRRRRSRTRTRSTSRTRSRSPYRDHRGYKRRR
158-171RRREKRARTRSRSP
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MASRRSRSPSTPSEGEIIESGSETKATTSQLPLNGTSVDRPTRASTSSAPRSAASLSRSPRRRRSRTRTRSTSRTRSRSPYRDHRGYKRRRDDDYDRDYNGYDHDDRRYRPEPSRRAGGSRYDDNRYSGRGQPRRPYYDYDREEHYGDGLRYSDESDRRREKRARTRSRSPYHEVRKPKQYSGDEWDSQKDESAVSRIRRRKPSIEQSVSERGNTSVVASRVKQDAETQKPQVQQASGASNPRLDRYVAALKPLMCGADCAPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.32
4 0.25
5 0.17
6 0.14
7 0.13
8 0.1
9 0.1
10 0.09
11 0.09
12 0.1
13 0.12
14 0.14
15 0.17
16 0.21
17 0.24
18 0.27
19 0.26
20 0.26
21 0.25
22 0.24
23 0.23
24 0.24
25 0.23
26 0.21
27 0.23
28 0.25
29 0.26
30 0.27
31 0.28
32 0.28
33 0.35
34 0.42
35 0.42
36 0.39
37 0.37
38 0.36
39 0.35
40 0.33
41 0.28
42 0.27
43 0.3
44 0.38
45 0.47
46 0.53
47 0.62
48 0.69
49 0.75
50 0.8
51 0.85
52 0.87
53 0.9
54 0.92
55 0.92
56 0.9
57 0.9
58 0.89
59 0.89
60 0.87
61 0.85
62 0.8
63 0.79
64 0.8
65 0.78
66 0.77
67 0.77
68 0.77
69 0.78
70 0.8
71 0.81
72 0.81
73 0.83
74 0.85
75 0.85
76 0.82
77 0.77
78 0.78
79 0.76
80 0.75
81 0.74
82 0.68
83 0.58
84 0.53
85 0.48
86 0.4
87 0.32
88 0.26
89 0.2
90 0.17
91 0.21
92 0.24
93 0.25
94 0.32
95 0.34
96 0.35
97 0.4
98 0.48
99 0.5
100 0.5
101 0.56
102 0.5
103 0.5
104 0.48
105 0.46
106 0.41
107 0.41
108 0.4
109 0.36
110 0.36
111 0.35
112 0.33
113 0.29
114 0.28
115 0.26
116 0.32
117 0.35
118 0.38
119 0.44
120 0.49
121 0.53
122 0.52
123 0.52
124 0.5
125 0.54
126 0.53
127 0.47
128 0.45
129 0.41
130 0.39
131 0.33
132 0.27
133 0.19
134 0.16
135 0.15
136 0.11
137 0.1
138 0.09
139 0.11
140 0.14
141 0.17
142 0.19
143 0.26
144 0.35
145 0.38
146 0.46
147 0.51
148 0.57
149 0.62
150 0.71
151 0.75
152 0.74
153 0.82
154 0.84
155 0.86
156 0.83
157 0.79
158 0.78
159 0.75
160 0.74
161 0.73
162 0.69
163 0.71
164 0.69
165 0.65
166 0.64
167 0.58
168 0.56
169 0.54
170 0.55
171 0.48
172 0.46
173 0.45
174 0.38
175 0.35
176 0.3
177 0.22
178 0.16
179 0.14
180 0.17
181 0.2
182 0.24
183 0.33
184 0.4
185 0.49
186 0.58
187 0.63
188 0.66
189 0.71
190 0.75
191 0.77
192 0.76
193 0.7
194 0.67
195 0.7
196 0.62
197 0.52
198 0.43
199 0.32
200 0.27
201 0.24
202 0.19
203 0.16
204 0.17
205 0.2
206 0.19
207 0.22
208 0.24
209 0.25
210 0.23
211 0.26
212 0.34
213 0.39
214 0.45
215 0.47
216 0.5
217 0.52
218 0.54
219 0.5
220 0.41
221 0.36
222 0.33
223 0.33
224 0.31
225 0.33
226 0.31
227 0.32
228 0.32
229 0.31
230 0.3
231 0.25
232 0.23
233 0.25
234 0.33
235 0.29
236 0.32
237 0.33
238 0.31
239 0.32
240 0.32
241 0.26
242 0.17
243 0.18