Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319EQ60

Protein Details
Accession A0A319EQ60   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
139-185GGEFEDKKKTRKRQNMGKKKRGRKGNKREGNKRGKKGKKWEEGEEVEBasic
NLS Segment(s)
PositionSequence
145-177KKKTRKRQNMGKKKRGRKGNKREGNKRGKKGKK
Subcellular Location(s) nucl 16, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MVLVMLYMVNSAGLNLQKMCRNVHLFSVALNLATTEQAIGRTNRCGQAFVVQVFDYRVPDTFQISLSKRATQKALPAILTDMSSSLAAILNPTNDYVEASRWVIRDKELIYVEDGDVKEDTDIDDPDRRLDAIMVALEGGEFEDKKKTRKRQNMGKKKRGRKGNKREGNKRGKKGKKWEEGEEVEEEVEEEGEEEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.16
4 0.2
5 0.23
6 0.25
7 0.3
8 0.33
9 0.33
10 0.35
11 0.34
12 0.3
13 0.28
14 0.29
15 0.22
16 0.17
17 0.16
18 0.12
19 0.1
20 0.1
21 0.09
22 0.06
23 0.06
24 0.08
25 0.11
26 0.13
27 0.14
28 0.18
29 0.22
30 0.27
31 0.27
32 0.26
33 0.24
34 0.28
35 0.3
36 0.26
37 0.25
38 0.2
39 0.2
40 0.2
41 0.2
42 0.15
43 0.12
44 0.12
45 0.11
46 0.12
47 0.13
48 0.13
49 0.13
50 0.18
51 0.19
52 0.25
53 0.26
54 0.3
55 0.3
56 0.32
57 0.33
58 0.29
59 0.32
60 0.3
61 0.31
62 0.26
63 0.24
64 0.23
65 0.2
66 0.19
67 0.14
68 0.09
69 0.07
70 0.07
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.05
82 0.06
83 0.06
84 0.07
85 0.07
86 0.08
87 0.1
88 0.1
89 0.11
90 0.11
91 0.11
92 0.14
93 0.13
94 0.16
95 0.16
96 0.16
97 0.16
98 0.16
99 0.15
100 0.16
101 0.15
102 0.12
103 0.11
104 0.11
105 0.09
106 0.08
107 0.09
108 0.07
109 0.08
110 0.09
111 0.13
112 0.13
113 0.14
114 0.15
115 0.14
116 0.13
117 0.12
118 0.11
119 0.08
120 0.07
121 0.06
122 0.05
123 0.05
124 0.05
125 0.04
126 0.04
127 0.04
128 0.04
129 0.05
130 0.13
131 0.15
132 0.23
133 0.33
134 0.42
135 0.52
136 0.63
137 0.72
138 0.76
139 0.86
140 0.9
141 0.92
142 0.93
143 0.92
144 0.92
145 0.91
146 0.9
147 0.9
148 0.9
149 0.9
150 0.91
151 0.9
152 0.91
153 0.92
154 0.92
155 0.92
156 0.91
157 0.9
158 0.89
159 0.9
160 0.89
161 0.9
162 0.89
163 0.88
164 0.85
165 0.82
166 0.8
167 0.74
168 0.68
169 0.59
170 0.49
171 0.38
172 0.32
173 0.25
174 0.16
175 0.12
176 0.08
177 0.06
178 0.06