Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319DI42

Protein Details
Accession A0A319DI42    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
187-212VTYKRTPQLDPPPQGKRRRNVSRRNKHydrophilic
NLS Segment(s)
PositionSequence
201-212GKRRRNVSRRNK
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MAPTKPTLHPLTTPRSMTFPSELRERTFTCLDLDRPLHEKKEEDEEGTITPPPAYTEFLNTFSPIFSSSTNSRANFYKYMLDKPCPSPTSPPPSTTSTTFPSGLPPKHAASHQAHPAPWTTKSPVHTTQRMRLPPPYLCTPVSASPRSAHPLRSPYTPPDWRPRPFDSPVSETGNSFSVRHVVTTTVTYKRTPQLDPPPQGKRRRNVSRRNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.42
4 0.4
5 0.39
6 0.35
7 0.32
8 0.37
9 0.38
10 0.37
11 0.41
12 0.38
13 0.39
14 0.37
15 0.34
16 0.3
17 0.32
18 0.29
19 0.31
20 0.31
21 0.28
22 0.31
23 0.34
24 0.34
25 0.32
26 0.32
27 0.28
28 0.36
29 0.34
30 0.31
31 0.29
32 0.27
33 0.26
34 0.25
35 0.23
36 0.15
37 0.13
38 0.11
39 0.11
40 0.11
41 0.13
42 0.12
43 0.16
44 0.18
45 0.21
46 0.22
47 0.21
48 0.19
49 0.17
50 0.17
51 0.13
52 0.12
53 0.09
54 0.13
55 0.14
56 0.2
57 0.25
58 0.25
59 0.25
60 0.27
61 0.3
62 0.27
63 0.27
64 0.28
65 0.25
66 0.31
67 0.33
68 0.33
69 0.33
70 0.35
71 0.4
72 0.35
73 0.35
74 0.34
75 0.36
76 0.42
77 0.41
78 0.39
79 0.36
80 0.39
81 0.4
82 0.36
83 0.33
84 0.27
85 0.28
86 0.26
87 0.23
88 0.24
89 0.26
90 0.25
91 0.24
92 0.24
93 0.22
94 0.23
95 0.23
96 0.24
97 0.23
98 0.27
99 0.29
100 0.28
101 0.27
102 0.26
103 0.29
104 0.25
105 0.23
106 0.21
107 0.19
108 0.2
109 0.22
110 0.27
111 0.32
112 0.36
113 0.42
114 0.43
115 0.47
116 0.51
117 0.52
118 0.49
119 0.46
120 0.44
121 0.4
122 0.41
123 0.38
124 0.34
125 0.31
126 0.31
127 0.3
128 0.31
129 0.34
130 0.3
131 0.27
132 0.25
133 0.27
134 0.31
135 0.29
136 0.27
137 0.26
138 0.31
139 0.32
140 0.36
141 0.37
142 0.36
143 0.43
144 0.46
145 0.46
146 0.51
147 0.56
148 0.55
149 0.59
150 0.6
151 0.58
152 0.57
153 0.58
154 0.53
155 0.51
156 0.51
157 0.51
158 0.45
159 0.39
160 0.36
161 0.32
162 0.28
163 0.23
164 0.19
165 0.17
166 0.16
167 0.17
168 0.16
169 0.14
170 0.15
171 0.18
172 0.22
173 0.23
174 0.25
175 0.26
176 0.3
177 0.35
178 0.38
179 0.37
180 0.42
181 0.48
182 0.56
183 0.62
184 0.66
185 0.69
186 0.74
187 0.81
188 0.8
189 0.79
190 0.8
191 0.84
192 0.86