Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319DPD2

Protein Details
Accession A0A319DPD2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
57-76NPKDIHPPIHPSKKKKRNKSBasic
NLS Segment(s)
PositionSequence
65-76IHPSKKKKRNKS
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MYACIYVIIIRQSYLRCAVLCCAVALVYNPYPLIPYTTSQPPIQTKYHRARYLAIPNPKDIHPPIHPSKKKKRNKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.17
4 0.18
5 0.19
6 0.19
7 0.19
8 0.16
9 0.13
10 0.11
11 0.1
12 0.1
13 0.12
14 0.1
15 0.1
16 0.09
17 0.09
18 0.1
19 0.1
20 0.11
21 0.09
22 0.09
23 0.12
24 0.15
25 0.18
26 0.17
27 0.21
28 0.21
29 0.24
30 0.28
31 0.29
32 0.35
33 0.42
34 0.51
35 0.51
36 0.49
37 0.48
38 0.51
39 0.57
40 0.56
41 0.56
42 0.49
43 0.49
44 0.5
45 0.48
46 0.45
47 0.38
48 0.36
49 0.31
50 0.38
51 0.45
52 0.53
53 0.6
54 0.65
55 0.74
56 0.79