Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D6RLL6

Protein Details
Accession D6RLL6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
78-106DVTSRRKRGKGAPKKAKTKDDSRRAKKKRBasic
NLS Segment(s)
PositionSequence
82-106RRKRGKGAPKKAKTKDDSRRAKKKR
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG cci:CC1G_14155  -  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSAIVPSRLAALAKLRCSIFQQTYNPTGVRTGAKYLKQKLRGPAMTMYYPTRLNISALARQLPELELVDEEEMERIEDVTSRRKRGKGAPKKAKTKDDSRRAKKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.27
4 0.3
5 0.36
6 0.33
7 0.34
8 0.37
9 0.38
10 0.41
11 0.43
12 0.39
13 0.33
14 0.29
15 0.24
16 0.22
17 0.18
18 0.21
19 0.23
20 0.29
21 0.35
22 0.42
23 0.47
24 0.52
25 0.55
26 0.55
27 0.59
28 0.54
29 0.51
30 0.46
31 0.42
32 0.35
33 0.32
34 0.28
35 0.21
36 0.2
37 0.17
38 0.15
39 0.12
40 0.12
41 0.13
42 0.14
43 0.15
44 0.15
45 0.16
46 0.15
47 0.15
48 0.15
49 0.12
50 0.11
51 0.08
52 0.08
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.07
65 0.1
66 0.19
67 0.25
68 0.31
69 0.37
70 0.39
71 0.44
72 0.52
73 0.62
74 0.63
75 0.69
76 0.74
77 0.78
78 0.86
79 0.89
80 0.89
81 0.85
82 0.85
83 0.84
84 0.83
85 0.85
86 0.85