Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319D2I2

Protein Details
Accession A0A319D2I2   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
31-51PPSFPRRRGLPEKRKIRDVKKBasic
NLS Segment(s)
PositionSequence
35-51PRRRGLPEKRKIRDVKK
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044304  NUBPL-like  
IPR027417  P-loop_NTPase  
IPR033756  YlxH/NBP35  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016787  F:hydrolase activity  
GO:0051536  F:iron-sulfur cluster binding  
GO:0016226  P:iron-sulfur cluster assembly  
Pfam View protein in Pfam  
PF10609  ParA  
Amino Acid Sequences MMATMSGKRLFSTCRPLWHDNPLGLPRSGTPPSFPRRRGLPEKRKIRDVKKVVAVSSAKGGVGKSTIAVNLALAFARRGIRTGILDTDIFGPSIPTLLNLSGEPRLDDSALPPIPPSYPIPKSHPLSPPSPSLPQRNTHQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.55
4 0.56
5 0.6
6 0.58
7 0.5
8 0.53
9 0.48
10 0.43
11 0.37
12 0.34
13 0.26
14 0.28
15 0.29
16 0.23
17 0.23
18 0.27
19 0.36
20 0.43
21 0.44
22 0.42
23 0.46
24 0.54
25 0.61
26 0.65
27 0.67
28 0.69
29 0.78
30 0.78
31 0.81
32 0.8
33 0.77
34 0.76
35 0.71
36 0.68
37 0.65
38 0.62
39 0.53
40 0.51
41 0.44
42 0.34
43 0.3
44 0.23
45 0.15
46 0.14
47 0.13
48 0.08
49 0.08
50 0.07
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.05
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.05
63 0.07
64 0.07
65 0.07
66 0.08
67 0.1
68 0.11
69 0.12
70 0.11
71 0.12
72 0.12
73 0.12
74 0.13
75 0.11
76 0.1
77 0.09
78 0.08
79 0.06
80 0.07
81 0.06
82 0.05
83 0.06
84 0.06
85 0.07
86 0.07
87 0.09
88 0.11
89 0.11
90 0.11
91 0.11
92 0.12
93 0.12
94 0.12
95 0.11
96 0.17
97 0.17
98 0.17
99 0.16
100 0.16
101 0.16
102 0.18
103 0.21
104 0.21
105 0.26
106 0.3
107 0.37
108 0.45
109 0.48
110 0.53
111 0.56
112 0.52
113 0.52
114 0.51
115 0.5
116 0.47
117 0.51
118 0.5
119 0.52
120 0.53
121 0.55