Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319DA82

Protein Details
Accession A0A319DA82    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
39-66VQPPNYQRKRARIPTRARPRPRLQHLLPHydrophilic
NLS Segment(s)
PositionSequence
46-60RKRARIPTRARPRPR
Subcellular Location(s) nucl 8mito 8mito_nucl 8, extr 5, cyto_nucl 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MRQAPAIAFPALPLAVHPLPARQPALLSPDHILPRRRLVQPPNYQRKRARIPTRARPRPRLQHLLPTRALLLQPSNSLAVWLLGLWLPQASSCCKVLGNQPTRAMLLHFALVSPSNTYTPLTDKRRSSMRGFGISILFDNIQFLSLYFPLFVCHGLPGYGTTYSLIHDLGYRQHKNLRNAMTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.16
4 0.17
5 0.18
6 0.21
7 0.26
8 0.27
9 0.2
10 0.21
11 0.21
12 0.25
13 0.23
14 0.21
15 0.19
16 0.23
17 0.28
18 0.32
19 0.33
20 0.32
21 0.39
22 0.43
23 0.46
24 0.48
25 0.51
26 0.56
27 0.63
28 0.71
29 0.75
30 0.74
31 0.77
32 0.76
33 0.77
34 0.77
35 0.77
36 0.76
37 0.74
38 0.78
39 0.81
40 0.86
41 0.87
42 0.85
43 0.84
44 0.83
45 0.83
46 0.82
47 0.8
48 0.71
49 0.71
50 0.69
51 0.66
52 0.58
53 0.48
54 0.41
55 0.32
56 0.3
57 0.21
58 0.17
59 0.11
60 0.11
61 0.11
62 0.11
63 0.1
64 0.1
65 0.08
66 0.07
67 0.06
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.03
74 0.03
75 0.03
76 0.05
77 0.06
78 0.08
79 0.09
80 0.09
81 0.09
82 0.11
83 0.17
84 0.25
85 0.29
86 0.3
87 0.31
88 0.31
89 0.32
90 0.31
91 0.25
92 0.17
93 0.12
94 0.1
95 0.08
96 0.07
97 0.07
98 0.08
99 0.08
100 0.08
101 0.08
102 0.08
103 0.09
104 0.09
105 0.1
106 0.14
107 0.22
108 0.28
109 0.33
110 0.34
111 0.37
112 0.44
113 0.47
114 0.46
115 0.45
116 0.44
117 0.42
118 0.42
119 0.39
120 0.34
121 0.3
122 0.26
123 0.2
124 0.15
125 0.1
126 0.1
127 0.08
128 0.08
129 0.08
130 0.07
131 0.08
132 0.08
133 0.09
134 0.09
135 0.09
136 0.09
137 0.09
138 0.1
139 0.08
140 0.09
141 0.09
142 0.09
143 0.09
144 0.1
145 0.12
146 0.11
147 0.11
148 0.11
149 0.11
150 0.12
151 0.12
152 0.11
153 0.09
154 0.1
155 0.11
156 0.18
157 0.28
158 0.29
159 0.32
160 0.41
161 0.48
162 0.53
163 0.6