Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319E6G1

Protein Details
Accession A0A319E6G1   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MDPSMVRDRKRNRRFLPPKKRYRKLLRNNIDGIHydrophilic
NLS Segment(s)
PositionSequence
8-49DRKRNRRFLPPKKRYRKLLRNNIDGITRPALRRLARRGGVVR
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MDPSMVRDRKRNRRFLPPKKRYRKLLRNNIDGITRPALRRLARRGGVVRIKKDVYAEVRRVIKDHMTDIMRHVINILDSATTPRHERKVVTNRDVVFALNRMGKTLYGFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.88
4 0.88
5 0.9
6 0.9
7 0.93
8 0.91
9 0.91
10 0.91
11 0.91
12 0.91
13 0.89
14 0.85
15 0.79
16 0.71
17 0.62
18 0.52
19 0.45
20 0.37
21 0.31
22 0.24
23 0.24
24 0.27
25 0.28
26 0.32
27 0.34
28 0.38
29 0.38
30 0.41
31 0.41
32 0.43
33 0.48
34 0.47
35 0.43
36 0.39
37 0.37
38 0.34
39 0.32
40 0.28
41 0.26
42 0.27
43 0.26
44 0.27
45 0.3
46 0.29
47 0.29
48 0.27
49 0.24
50 0.2
51 0.19
52 0.2
53 0.18
54 0.18
55 0.19
56 0.24
57 0.21
58 0.19
59 0.18
60 0.14
61 0.13
62 0.13
63 0.11
64 0.06
65 0.06
66 0.09
67 0.1
68 0.11
69 0.14
70 0.18
71 0.23
72 0.24
73 0.27
74 0.35
75 0.44
76 0.52
77 0.54
78 0.56
79 0.52
80 0.53
81 0.51
82 0.42
83 0.33
84 0.26
85 0.24
86 0.22
87 0.21
88 0.2
89 0.21
90 0.2