Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319D9L2

Protein Details
Accession A0A319D9L2   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
70-96GRISRRIMPHRVPRQQRLRSRQSTNDEHydrophilic
NLS Segment(s)
PositionSequence
63-80PLSRPGGGRISRRIMPHR
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MVYGVEAQDSEGNSASASESNACRAPTATELAQRTYARPTTPGQTPSGHAPRGQSPRGDGRQPLSRPGGGRISRRIMPHRVPRQQRLRSRQSTNDELV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.09
5 0.1
6 0.1
7 0.13
8 0.16
9 0.16
10 0.15
11 0.15
12 0.16
13 0.16
14 0.19
15 0.17
16 0.2
17 0.22
18 0.23
19 0.27
20 0.25
21 0.24
22 0.25
23 0.25
24 0.2
25 0.21
26 0.21
27 0.2
28 0.24
29 0.25
30 0.23
31 0.23
32 0.23
33 0.28
34 0.3
35 0.27
36 0.23
37 0.23
38 0.27
39 0.32
40 0.32
41 0.26
42 0.25
43 0.32
44 0.35
45 0.35
46 0.3
47 0.28
48 0.35
49 0.36
50 0.37
51 0.33
52 0.31
53 0.3
54 0.33
55 0.37
56 0.33
57 0.37
58 0.38
59 0.39
60 0.41
61 0.45
62 0.47
63 0.46
64 0.51
65 0.57
66 0.62
67 0.67
68 0.72
69 0.77
70 0.81
71 0.84
72 0.85
73 0.84
74 0.85
75 0.84
76 0.83
77 0.82
78 0.79