Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319D119

Protein Details
Accession A0A319D119   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-48ASPSGTTVTKPRRRRDKPQFSCNACRQRRSRCDRLQPCSSCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSMMQDPASPSGTTVTKPRRRRDKPQFSCNACRQRRSRCDRLQPCSSCASRSQPCGYVNTKPSTGGTPAVHDRIVQLERLVKSLTPNIDQNNPNILSTPEVKAGGSSVPGSGSVVDGQSECGSMHITGSELR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.34
3 0.41
4 0.5
5 0.6
6 0.67
7 0.75
8 0.84
9 0.86
10 0.87
11 0.88
12 0.9
13 0.9
14 0.86
15 0.87
16 0.85
17 0.84
18 0.77
19 0.76
20 0.72
21 0.73
22 0.76
23 0.76
24 0.77
25 0.76
26 0.82
27 0.82
28 0.83
29 0.82
30 0.74
31 0.68
32 0.63
33 0.54
34 0.45
35 0.39
36 0.39
37 0.32
38 0.34
39 0.33
40 0.32
41 0.32
42 0.35
43 0.34
44 0.32
45 0.33
46 0.31
47 0.29
48 0.25
49 0.25
50 0.22
51 0.2
52 0.18
53 0.14
54 0.15
55 0.16
56 0.17
57 0.16
58 0.14
59 0.13
60 0.14
61 0.14
62 0.12
63 0.11
64 0.15
65 0.15
66 0.16
67 0.16
68 0.13
69 0.14
70 0.18
71 0.19
72 0.17
73 0.19
74 0.21
75 0.27
76 0.28
77 0.28
78 0.3
79 0.28
80 0.26
81 0.24
82 0.22
83 0.18
84 0.19
85 0.19
86 0.16
87 0.15
88 0.15
89 0.14
90 0.15
91 0.12
92 0.11
93 0.1
94 0.08
95 0.08
96 0.08
97 0.09
98 0.08
99 0.08
100 0.08
101 0.08
102 0.08
103 0.08
104 0.1
105 0.1
106 0.1
107 0.09
108 0.09
109 0.11
110 0.1
111 0.1
112 0.09