Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319D5J7

Protein Details
Accession A0A319D5J7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-39IPKAPGSYKKLIRQKRDRRKKSLMKKVCEYSRHydrophilic
NLS Segment(s)
PositionSequence
10-31KAPGSYKKLIRQKRDRRKKSLM
Subcellular Location(s) nucl 24.5, cyto_nucl 14.333, mito_nucl 13.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MSMGKCKIPKAPGSYKKLIRQKRDRRKKSLMKKVCEYSRMCGADVCLGIRIRESGEVTTFLANSTGFWSSLNSQLETYYPLPVQKTDKDFDLTYSTRRNTVRDDANQSPNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.72
3 0.75
4 0.78
5 0.78
6 0.78
7 0.8
8 0.83
9 0.85
10 0.89
11 0.89
12 0.89
13 0.91
14 0.91
15 0.91
16 0.91
17 0.89
18 0.85
19 0.83
20 0.82
21 0.75
22 0.71
23 0.62
24 0.55
25 0.54
26 0.47
27 0.4
28 0.32
29 0.28
30 0.24
31 0.22
32 0.18
33 0.12
34 0.11
35 0.11
36 0.11
37 0.1
38 0.08
39 0.09
40 0.1
41 0.08
42 0.08
43 0.09
44 0.1
45 0.1
46 0.09
47 0.08
48 0.07
49 0.07
50 0.06
51 0.07
52 0.07
53 0.07
54 0.07
55 0.09
56 0.09
57 0.16
58 0.17
59 0.16
60 0.15
61 0.16
62 0.16
63 0.19
64 0.18
65 0.14
66 0.14
67 0.15
68 0.16
69 0.18
70 0.22
71 0.24
72 0.28
73 0.28
74 0.29
75 0.31
76 0.31
77 0.3
78 0.33
79 0.29
80 0.29
81 0.35
82 0.34
83 0.36
84 0.38
85 0.38
86 0.37
87 0.44
88 0.48
89 0.48
90 0.55
91 0.56