Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319D0J7

Protein Details
Accession A0A319D0J7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-86TNCDQCTRTRNRQQTKYMLKTSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 8, plas 7, mito 5, E.R. 4, cyto 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MSQCYSVSTVEALSCRGVGLVEFNWVGCRYIYPPPIHRTSRITTRIVTVLIILVVLQTTPTINNTNCDQCTRTRNRQQTKYMLKTSPRHPTRPHTIGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.08
5 0.07
6 0.09
7 0.08
8 0.1
9 0.1
10 0.1
11 0.12
12 0.12
13 0.13
14 0.1
15 0.11
16 0.12
17 0.18
18 0.23
19 0.24
20 0.29
21 0.34
22 0.4
23 0.41
24 0.41
25 0.4
26 0.39
27 0.45
28 0.44
29 0.4
30 0.34
31 0.34
32 0.32
33 0.27
34 0.23
35 0.14
36 0.09
37 0.07
38 0.06
39 0.04
40 0.03
41 0.03
42 0.02
43 0.02
44 0.02
45 0.03
46 0.03
47 0.05
48 0.09
49 0.1
50 0.12
51 0.15
52 0.2
53 0.21
54 0.23
55 0.23
56 0.24
57 0.34
58 0.4
59 0.48
60 0.53
61 0.63
62 0.7
63 0.77
64 0.8
65 0.81
66 0.82
67 0.8
68 0.77
69 0.73
70 0.71
71 0.7
72 0.71
73 0.71
74 0.67
75 0.66
76 0.66
77 0.69
78 0.71