Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319ES71

Protein Details
Accession A0A319ES71    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MARSRRIRKRPLNSPRSRQQQRARRKENLFHydrophilic
NLS Segment(s)
PositionSequence
4-26SRRIRKRPLNSPRSRQQQRARRK
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MARSRRIRKRPLNSPRSRQQQRARRKENLFLKSFEYCQECDTDIFIMLLSAEESASHYPKPNEITW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.88
4 0.85
5 0.83
6 0.82
7 0.81
8 0.82
9 0.84
10 0.82
11 0.8
12 0.77
13 0.77
14 0.76
15 0.73
16 0.64
17 0.55
18 0.5
19 0.43
20 0.39
21 0.33
22 0.26
23 0.19
24 0.17
25 0.17
26 0.15
27 0.14
28 0.14
29 0.12
30 0.1
31 0.09
32 0.08
33 0.07
34 0.06
35 0.05
36 0.05
37 0.04
38 0.04
39 0.04
40 0.06
41 0.09
42 0.11
43 0.13
44 0.18
45 0.19
46 0.24