Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319E1T3

Protein Details
Accession A0A319E1T3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
152-188NPELTKVTKKNVRREHRANKTNKVKVVKDKVRRIASTHydrophilic
NLS Segment(s)
PositionSequence
160-186KKNVRREHRANKTNKVKVVKDKVRRIA
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MGSIVHASKSFMLRYSPINKPSPIANRYLLSNNNCLQPKIAHMYATRDKNSLWWKTSASQLTSYRRVIRSWGSRRARVTFRKALQEQGFDEEGRRIELENQDGKQNNRKNLSGSLEVILRAHVIEEQFDVLQKDMQAGVRSLLTHIKHLEANPELTKVTKKNVRREHRANKTNKVKVVKDKVRRIASTGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.33
3 0.37
4 0.41
5 0.45
6 0.44
7 0.43
8 0.49
9 0.5
10 0.46
11 0.43
12 0.4
13 0.37
14 0.39
15 0.43
16 0.41
17 0.36
18 0.39
19 0.37
20 0.4
21 0.4
22 0.37
23 0.34
24 0.28
25 0.29
26 0.3
27 0.29
28 0.25
29 0.24
30 0.32
31 0.37
32 0.43
33 0.4
34 0.34
35 0.33
36 0.37
37 0.44
38 0.41
39 0.37
40 0.33
41 0.33
42 0.34
43 0.41
44 0.37
45 0.32
46 0.32
47 0.35
48 0.38
49 0.41
50 0.42
51 0.41
52 0.39
53 0.37
54 0.34
55 0.36
56 0.4
57 0.42
58 0.49
59 0.49
60 0.52
61 0.55
62 0.57
63 0.58
64 0.55
65 0.56
66 0.53
67 0.51
68 0.55
69 0.53
70 0.54
71 0.48
72 0.44
73 0.37
74 0.32
75 0.3
76 0.21
77 0.21
78 0.16
79 0.14
80 0.12
81 0.11
82 0.08
83 0.09
84 0.11
85 0.15
86 0.17
87 0.17
88 0.2
89 0.23
90 0.24
91 0.3
92 0.34
93 0.35
94 0.36
95 0.36
96 0.35
97 0.36
98 0.39
99 0.32
100 0.28
101 0.24
102 0.21
103 0.2
104 0.17
105 0.13
106 0.09
107 0.07
108 0.06
109 0.06
110 0.05
111 0.06
112 0.06
113 0.07
114 0.07
115 0.08
116 0.09
117 0.08
118 0.09
119 0.08
120 0.09
121 0.09
122 0.11
123 0.11
124 0.11
125 0.12
126 0.11
127 0.11
128 0.12
129 0.17
130 0.15
131 0.17
132 0.18
133 0.19
134 0.21
135 0.21
136 0.25
137 0.22
138 0.25
139 0.23
140 0.23
141 0.22
142 0.21
143 0.26
144 0.23
145 0.29
146 0.33
147 0.4
148 0.49
149 0.6
150 0.68
151 0.73
152 0.81
153 0.84
154 0.87
155 0.89
156 0.86
157 0.86
158 0.87
159 0.85
160 0.81
161 0.78
162 0.74
163 0.76
164 0.79
165 0.78
166 0.78
167 0.8
168 0.83
169 0.83
170 0.77