Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319DNT5

Protein Details
Accession A0A319DNT5    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-40VNVPKTRRTYCKSKECHKHTQHKVTQYKAHydrophilic
83-103ECTACKTKKQLSLKRCKHFELHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MQRLTPSFRIQVNVPKTRRTYCKSKECHKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLECTACKTKKQLSLKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.54
4 0.58
5 0.63
6 0.6
7 0.62
8 0.62
9 0.7
10 0.71
11 0.77
12 0.8
13 0.8
14 0.84
15 0.83
16 0.84
17 0.84
18 0.86
19 0.82
20 0.82
21 0.8
22 0.73
23 0.72
24 0.65
25 0.6
26 0.52
27 0.49
28 0.39
29 0.34
30 0.32
31 0.32
32 0.3
33 0.27
34 0.32
35 0.36
36 0.4
37 0.45
38 0.49
39 0.45
40 0.52
41 0.59
42 0.56
43 0.58
44 0.56
45 0.56
46 0.54
47 0.57
48 0.48
49 0.43
50 0.4
51 0.33
52 0.35
53 0.37
54 0.36
55 0.31
56 0.38
57 0.43
58 0.51
59 0.6
60 0.63
61 0.62
62 0.66
63 0.73
64 0.73
65 0.72
66 0.69
67 0.64
68 0.61
69 0.59
70 0.54
71 0.49
72 0.49
73 0.44
74 0.41
75 0.42
76 0.44
77 0.48
78 0.57
79 0.61
80 0.64
81 0.73
82 0.79
83 0.83
84 0.81
85 0.76
86 0.7
87 0.64
88 0.61
89 0.6
90 0.59
91 0.57
92 0.58
93 0.54
94 0.5
95 0.49
96 0.42