Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319DBJ0

Protein Details
Accession A0A319DBJ0    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
61-83NLVAHRKGKNHKKRVRILREEAHBasic
NLS Segment(s)
PositionSequence
66-76RKGKNHKKRVR
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGAVRKIKTKRMTRGYDQVRADIASSKHLSQYKASKDAEDLPGLGKHYCVECSKWFESDFNLVAHRKGKNHKKRVRILREEAHSQKAAEAAVGLGTDNGVRSKDAVVEMED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.78
3 0.76
4 0.68
5 0.6
6 0.51
7 0.43
8 0.37
9 0.32
10 0.25
11 0.23
12 0.23
13 0.22
14 0.26
15 0.28
16 0.29
17 0.29
18 0.36
19 0.36
20 0.41
21 0.41
22 0.36
23 0.35
24 0.38
25 0.35
26 0.28
27 0.22
28 0.17
29 0.17
30 0.18
31 0.16
32 0.11
33 0.1
34 0.1
35 0.12
36 0.11
37 0.13
38 0.14
39 0.21
40 0.21
41 0.22
42 0.22
43 0.2
44 0.21
45 0.21
46 0.19
47 0.14
48 0.16
49 0.15
50 0.16
51 0.19
52 0.2
53 0.21
54 0.3
55 0.4
56 0.48
57 0.59
58 0.65
59 0.7
60 0.78
61 0.85
62 0.86
63 0.83
64 0.8
65 0.77
66 0.75
67 0.74
68 0.67
69 0.61
70 0.52
71 0.43
72 0.36
73 0.29
74 0.24
75 0.16
76 0.12
77 0.07
78 0.07
79 0.06
80 0.06
81 0.04
82 0.05
83 0.05
84 0.06
85 0.07
86 0.07
87 0.08
88 0.09
89 0.1
90 0.13
91 0.14