Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319DNG4

Protein Details
Accession A0A319DNG4    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-33FRTIRGRHSVYPRSKRQQRLRRRLRLMYGAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 11.166, nucl 8.5, cyto_nucl 8.333, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MVNFRTIRGRHSVYPRSKRQQRLRRRLRLMYGAFEYCHECDADICVLIRLNDTGQIYIFNSDSQWQPSKEQLVCLQLSLAKIETNKLQASYYPKPKQVTWEELASKYRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.75
3 0.78
4 0.82
5 0.85
6 0.87
7 0.87
8 0.88
9 0.9
10 0.91
11 0.9
12 0.9
13 0.86
14 0.81
15 0.8
16 0.71
17 0.64
18 0.56
19 0.47
20 0.39
21 0.33
22 0.29
23 0.2
24 0.19
25 0.14
26 0.1
27 0.09
28 0.11
29 0.1
30 0.08
31 0.07
32 0.07
33 0.08
34 0.07
35 0.08
36 0.06
37 0.06
38 0.08
39 0.08
40 0.08
41 0.08
42 0.08
43 0.08
44 0.09
45 0.09
46 0.06
47 0.06
48 0.08
49 0.09
50 0.12
51 0.15
52 0.15
53 0.16
54 0.19
55 0.25
56 0.24
57 0.25
58 0.24
59 0.25
60 0.24
61 0.23
62 0.2
63 0.16
64 0.16
65 0.15
66 0.13
67 0.1
68 0.1
69 0.12
70 0.14
71 0.16
72 0.17
73 0.17
74 0.17
75 0.19
76 0.27
77 0.34
78 0.42
79 0.45
80 0.5
81 0.52
82 0.53
83 0.58
84 0.57
85 0.56
86 0.5
87 0.52
88 0.5
89 0.5