Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317WKZ3

Protein Details
Accession A0A317WKZ3    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
54-97LKRQSKSTTPPLPPKKKRKTRKKSWRRKRKREKKRKKKLRINTEBasic
NLS Segment(s)
PositionSequence
56-93RQSKSTTPPLPPKKKRKTRKKSWRRKRKREKKRKKKLR
Subcellular Location(s) mito 25, nucl 1.5, cyto_nucl 1.5
Family & Domain DBs
Amino Acid Sequences MCGYLRLVISVQPVRQSTRNSRAIAQSTIIPGLRLIIVKFVRIQVRWQSGARVLKRQSKSTTPPLPPKKKRKTRKKSWRRKRKREKKRKKKLRINTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.4
4 0.42
5 0.48
6 0.53
7 0.5
8 0.52
9 0.53
10 0.52
11 0.47
12 0.39
13 0.31
14 0.25
15 0.25
16 0.22
17 0.16
18 0.12
19 0.11
20 0.1
21 0.09
22 0.08
23 0.12
24 0.12
25 0.13
26 0.14
27 0.16
28 0.18
29 0.18
30 0.22
31 0.22
32 0.26
33 0.27
34 0.27
35 0.25
36 0.27
37 0.33
38 0.32
39 0.32
40 0.32
41 0.38
42 0.41
43 0.44
44 0.43
45 0.43
46 0.48
47 0.5
48 0.55
49 0.53
50 0.6
51 0.66
52 0.73
53 0.77
54 0.82
55 0.84
56 0.86
57 0.91
58 0.92
59 0.92
60 0.93
61 0.94
62 0.95
63 0.95
64 0.96
65 0.97
66 0.97
67 0.97
68 0.97
69 0.97
70 0.97
71 0.97
72 0.98
73 0.98
74 0.98
75 0.97
76 0.97
77 0.97