Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317VHB3

Protein Details
Accession A0A317VHB3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRKSKKRKGIYQDSRFKTSPHydrophilic
NLS Segment(s)
PositionSequence
5-7KKR
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MRKSKKRKGIYQDSRFKTSPRSARSPSGSETRWSCHPCAPTAASAVPQTQRERQTQKPLSPALSLGPCPCPCRQLQHPAQPGPQAPGPAYSHSPCPCPASPSSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.74
3 0.64
4 0.61
5 0.59
6 0.57
7 0.54
8 0.56
9 0.53
10 0.6
11 0.63
12 0.59
13 0.53
14 0.51
15 0.45
16 0.41
17 0.39
18 0.35
19 0.37
20 0.36
21 0.34
22 0.32
23 0.32
24 0.3
25 0.31
26 0.29
27 0.23
28 0.22
29 0.2
30 0.17
31 0.16
32 0.16
33 0.15
34 0.17
35 0.18
36 0.21
37 0.25
38 0.29
39 0.34
40 0.37
41 0.45
42 0.47
43 0.48
44 0.48
45 0.46
46 0.42
47 0.37
48 0.32
49 0.24
50 0.21
51 0.19
52 0.15
53 0.18
54 0.18
55 0.2
56 0.21
57 0.21
58 0.2
59 0.27
60 0.32
61 0.37
62 0.44
63 0.51
64 0.58
65 0.59
66 0.61
67 0.57
68 0.53
69 0.47
70 0.4
71 0.31
72 0.24
73 0.25
74 0.25
75 0.25
76 0.28
77 0.26
78 0.31
79 0.32
80 0.34
81 0.32
82 0.36
83 0.34
84 0.34