Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317WUV4

Protein Details
Accession A0A317WUV4    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-64FTELLSPKPKHPKPTPKPTPTPTPTHydrophilic
NLS Segment(s)
PositionSequence
47-56KPKHPKPTPK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011146  HIT-like  
IPR036265  HIT-like_sf  
IPR032566  Znf-C2HE  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0016787  F:hydrolase activity  
GO:0046872  F:metal ion binding  
GO:0006139  P:nucleobase-containing compound metabolic process  
Pfam View protein in Pfam  
PF01230  HIT  
PF16278  zf-C2HE  
Amino Acid Sequences MADSASEEAQRPQSQSQSQSQSQSQSQSQPPQKPAKRDAFTELLSPKPKHPKPTPKPTPTPTPTASSHRRRIGGPRDALGAYITQPTSHPNTVIYQTPLFVAIHDAFPKSTVHLLLLPRDSQKTRLHPFSAFEDLDFLAGVKTEAAKLKRLAAGELRRIHGKYSLQERARQQALDIDPAPEELPAGRDWEREIMCGVHAHPSMNHLHVHVISVDRFSERLKHRKHYNSFSTPFFVDLEDLPLAKDDVRRDPDGEGYLRRDLVCWRCGRGFGNRFAELKVHLQEEFGEWRRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.49
4 0.5
5 0.52
6 0.54
7 0.53
8 0.52
9 0.5
10 0.5
11 0.45
12 0.44
13 0.47
14 0.51
15 0.56
16 0.58
17 0.63
18 0.68
19 0.7
20 0.72
21 0.74
22 0.74
23 0.7
24 0.65
25 0.64
26 0.58
27 0.53
28 0.51
29 0.44
30 0.4
31 0.44
32 0.42
33 0.43
34 0.49
35 0.52
36 0.56
37 0.63
38 0.68
39 0.71
40 0.81
41 0.85
42 0.83
43 0.88
44 0.84
45 0.84
46 0.76
47 0.73
48 0.65
49 0.59
50 0.53
51 0.53
52 0.57
53 0.55
54 0.59
55 0.58
56 0.58
57 0.55
58 0.6
59 0.61
60 0.6
61 0.54
62 0.47
63 0.44
64 0.42
65 0.4
66 0.31
67 0.22
68 0.14
69 0.14
70 0.12
71 0.09
72 0.1
73 0.13
74 0.18
75 0.18
76 0.17
77 0.16
78 0.18
79 0.2
80 0.22
81 0.22
82 0.17
83 0.16
84 0.16
85 0.16
86 0.13
87 0.11
88 0.12
89 0.1
90 0.12
91 0.12
92 0.12
93 0.11
94 0.12
95 0.12
96 0.1
97 0.1
98 0.09
99 0.09
100 0.12
101 0.14
102 0.16
103 0.17
104 0.17
105 0.18
106 0.21
107 0.2
108 0.22
109 0.27
110 0.31
111 0.35
112 0.38
113 0.39
114 0.37
115 0.38
116 0.36
117 0.36
118 0.28
119 0.22
120 0.19
121 0.17
122 0.15
123 0.13
124 0.09
125 0.04
126 0.04
127 0.04
128 0.03
129 0.03
130 0.05
131 0.08
132 0.09
133 0.12
134 0.13
135 0.15
136 0.18
137 0.18
138 0.18
139 0.21
140 0.24
141 0.28
142 0.3
143 0.29
144 0.29
145 0.29
146 0.29
147 0.26
148 0.24
149 0.22
150 0.27
151 0.34
152 0.33
153 0.38
154 0.39
155 0.41
156 0.41
157 0.36
158 0.29
159 0.27
160 0.26
161 0.25
162 0.23
163 0.18
164 0.16
165 0.17
166 0.16
167 0.1
168 0.09
169 0.05
170 0.07
171 0.06
172 0.1
173 0.1
174 0.1
175 0.11
176 0.16
177 0.17
178 0.16
179 0.16
180 0.13
181 0.13
182 0.14
183 0.13
184 0.14
185 0.14
186 0.14
187 0.13
188 0.16
189 0.17
190 0.18
191 0.18
192 0.13
193 0.14
194 0.14
195 0.15
196 0.13
197 0.13
198 0.11
199 0.12
200 0.12
201 0.11
202 0.11
203 0.11
204 0.19
205 0.24
206 0.34
207 0.39
208 0.47
209 0.56
210 0.66
211 0.73
212 0.74
213 0.76
214 0.76
215 0.74
216 0.68
217 0.62
218 0.52
219 0.45
220 0.36
221 0.27
222 0.19
223 0.16
224 0.16
225 0.13
226 0.13
227 0.12
228 0.12
229 0.12
230 0.12
231 0.15
232 0.15
233 0.23
234 0.28
235 0.31
236 0.31
237 0.33
238 0.35
239 0.35
240 0.35
241 0.31
242 0.29
243 0.3
244 0.3
245 0.29
246 0.26
247 0.3
248 0.32
249 0.36
250 0.34
251 0.37
252 0.37
253 0.4
254 0.42
255 0.45
256 0.46
257 0.48
258 0.52
259 0.51
260 0.5
261 0.48
262 0.47
263 0.39
264 0.39
265 0.33
266 0.28
267 0.24
268 0.24
269 0.23
270 0.25
271 0.3