Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317WFB8

Protein Details
Accession A0A317WFB8    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-38ASTSWCSRTRRSRFPRPGCAHVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045861  CorA_cytoplasmic_dom  
Amino Acid Sequences MSRNHLNPYRSPTPQASTSWCSRTRRSRFPRPGCAHVSRVRERIRRSQDYPVRAVSSDWICYALIDDIIDIFTPYMRATEQTADLIEDQVLIARGDDIKALIPHPSSRKSTTSARASRSSPAGSAGNTTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.43
4 0.42
5 0.44
6 0.45
7 0.47
8 0.47
9 0.51
10 0.59
11 0.61
12 0.67
13 0.71
14 0.76
15 0.8
16 0.84
17 0.87
18 0.83
19 0.81
20 0.77
21 0.72
22 0.67
23 0.63
24 0.62
25 0.56
26 0.57
27 0.58
28 0.57
29 0.57
30 0.61
31 0.63
32 0.63
33 0.61
34 0.64
35 0.63
36 0.61
37 0.58
38 0.5
39 0.43
40 0.36
41 0.32
42 0.25
43 0.2
44 0.17
45 0.14
46 0.13
47 0.11
48 0.11
49 0.11
50 0.07
51 0.06
52 0.05
53 0.05
54 0.04
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.03
61 0.04
62 0.04
63 0.04
64 0.05
65 0.07
66 0.09
67 0.1
68 0.1
69 0.1
70 0.11
71 0.11
72 0.1
73 0.08
74 0.07
75 0.06
76 0.06
77 0.06
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.06
84 0.06
85 0.07
86 0.08
87 0.09
88 0.11
89 0.12
90 0.17
91 0.22
92 0.27
93 0.3
94 0.33
95 0.36
96 0.39
97 0.45
98 0.48
99 0.54
100 0.55
101 0.56
102 0.56
103 0.55
104 0.55
105 0.53
106 0.46
107 0.36
108 0.33
109 0.3
110 0.26