Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317X1A7

Protein Details
Accession A0A317X1A7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
93-117HTVTEGKKQDPKKKGKERNTSMPPPBasic
NLS Segment(s)
PositionSequence
99-110KKQDPKKKGKER
Subcellular Location(s) mito 20.5, cyto_mito 12, plas 3
Family & Domain DBs
Amino Acid Sequences MGWLRPPRIALRPCCVASCFRLPGLLAWHLPTVQSQLLNIPWHHWILARILFPSSLVAAAAQTGSRATNMFQCGEFTETSHLIIPSDLRPRDHTVTEGKKQDPKKKGKERNTSMPPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.4
4 0.38
5 0.39
6 0.34
7 0.28
8 0.28
9 0.26
10 0.26
11 0.27
12 0.25
13 0.18
14 0.18
15 0.18
16 0.17
17 0.17
18 0.15
19 0.14
20 0.12
21 0.12
22 0.1
23 0.11
24 0.14
25 0.16
26 0.16
27 0.14
28 0.15
29 0.15
30 0.15
31 0.14
32 0.12
33 0.13
34 0.16
35 0.15
36 0.13
37 0.13
38 0.13
39 0.12
40 0.12
41 0.09
42 0.05
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.03
49 0.03
50 0.03
51 0.04
52 0.04
53 0.05
54 0.05
55 0.09
56 0.11
57 0.11
58 0.11
59 0.12
60 0.13
61 0.15
62 0.14
63 0.11
64 0.13
65 0.12
66 0.13
67 0.14
68 0.13
69 0.11
70 0.11
71 0.12
72 0.13
73 0.21
74 0.21
75 0.22
76 0.26
77 0.32
78 0.36
79 0.35
80 0.34
81 0.36
82 0.42
83 0.48
84 0.5
85 0.48
86 0.52
87 0.6
88 0.67
89 0.67
90 0.7
91 0.74
92 0.79
93 0.85
94 0.88
95 0.91
96 0.9
97 0.91