Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317VMV4

Protein Details
Accession A0A317VMV4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
92-117LPCPAWWKWKWKWKWKWNSCRPSAATHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 5, extr 5, golg 3, cyto 1, pero 1, E.R. 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKPSFLPAWLFANPFLLPLLSRFSFLFFFCALIKICLLLVPFFSTSLLRTGARPSASNHGEKSKTRRKTGFGPPRLPTLDAVLRYGGTCPALPCPAWWKWKWKWKWKWNSCRPSAAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.12
4 0.1
5 0.1
6 0.16
7 0.13
8 0.15
9 0.15
10 0.16
11 0.17
12 0.17
13 0.19
14 0.13
15 0.14
16 0.13
17 0.15
18 0.13
19 0.13
20 0.12
21 0.1
22 0.1
23 0.09
24 0.1
25 0.07
26 0.07
27 0.08
28 0.08
29 0.08
30 0.09
31 0.08
32 0.08
33 0.1
34 0.11
35 0.1
36 0.1
37 0.12
38 0.14
39 0.15
40 0.15
41 0.16
42 0.21
43 0.23
44 0.25
45 0.24
46 0.26
47 0.28
48 0.29
49 0.36
50 0.38
51 0.42
52 0.47
53 0.49
54 0.48
55 0.53
56 0.62
57 0.64
58 0.62
59 0.63
60 0.58
61 0.6
62 0.57
63 0.5
64 0.39
65 0.34
66 0.3
67 0.24
68 0.23
69 0.18
70 0.17
71 0.16
72 0.16
73 0.12
74 0.1
75 0.1
76 0.09
77 0.12
78 0.14
79 0.14
80 0.15
81 0.19
82 0.24
83 0.31
84 0.33
85 0.39
86 0.46
87 0.56
88 0.65
89 0.7
90 0.76
91 0.79
92 0.88
93 0.9
94 0.92
95 0.93
96 0.93
97 0.89