Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317X781

Protein Details
Accession A0A317X781    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
57-76ELELERERKRERERERERKSBasic
NLS Segment(s)
PositionSequence
63-76ERKRERERERERKS
Subcellular Location(s) mito 15.5, cyto_mito 9.5, nucl 7, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MLSLRLGSREPSGGGWRFWWFPVLVRRSWAFFFFDTHEGGKGWKGGGEGGVESWELELELERERKRERERERERKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.25
4 0.24
5 0.23
6 0.23
7 0.16
8 0.19
9 0.27
10 0.28
11 0.26
12 0.28
13 0.28
14 0.29
15 0.3
16 0.26
17 0.2
18 0.17
19 0.18
20 0.18
21 0.18
22 0.17
23 0.16
24 0.15
25 0.13
26 0.13
27 0.12
28 0.09
29 0.08
30 0.08
31 0.07
32 0.07
33 0.08
34 0.08
35 0.07
36 0.07
37 0.07
38 0.06
39 0.06
40 0.06
41 0.05
42 0.04
43 0.04
44 0.05
45 0.05
46 0.1
47 0.16
48 0.17
49 0.22
50 0.26
51 0.35
52 0.43
53 0.52
54 0.58
55 0.64
56 0.74