Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317UIR8

Protein Details
Accession A0A317UIR8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
31-55RDHSTASKKKRNRSCRPAPPPFRPLHydrophilic
NLS Segment(s)
PositionSequence
40-40K
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
Amino Acid Sequences GARGPPTPLRIPTAVQGPPPRAPSPFGTGSRDHSTASKKKRNRSCRPAPPPFRPLGCSFHPAPSALPCPRPRRYTPEGPFLPAGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.35
4 0.35
5 0.37
6 0.4
7 0.38
8 0.33
9 0.34
10 0.32
11 0.33
12 0.34
13 0.33
14 0.32
15 0.32
16 0.36
17 0.37
18 0.35
19 0.3
20 0.27
21 0.32
22 0.36
23 0.44
24 0.47
25 0.48
26 0.57
27 0.66
28 0.74
29 0.77
30 0.79
31 0.8
32 0.82
33 0.86
34 0.88
35 0.85
36 0.81
37 0.76
38 0.69
39 0.61
40 0.53
41 0.47
42 0.41
43 0.37
44 0.34
45 0.31
46 0.31
47 0.3
48 0.27
49 0.25
50 0.24
51 0.28
52 0.26
53 0.32
54 0.36
55 0.43
56 0.49
57 0.55
58 0.56
59 0.58
60 0.63
61 0.67
62 0.65
63 0.68
64 0.64
65 0.62