Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317X0G7

Protein Details
Accession A0A317X0G7    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-44GRGGREKKTKEVQMKERRRRRWRDWREAWREREGRBasic
NLS Segment(s)
PositionSequence
11-46RGGREKKTKEVQMKERRRRRWRDWREAWREREGRGG
87-110RHARSGRKRTSAASASGKKRGRPL
Subcellular Location(s) nucl 18, mito 6, cyto 2
Family & Domain DBs
Amino Acid Sequences MLTENSGGVGRGGREKKTKEVQMKERRRRRWRDWREAWREREGRGGEERREEEVEVEEAEAEGSRWPVRNGGREGGSIRVSFFWGLRHARSGRKRTSAASASGKKRGRPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.45
4 0.52
5 0.6
6 0.61
7 0.67
8 0.72
9 0.76
10 0.84
11 0.86
12 0.87
13 0.89
14 0.9
15 0.9
16 0.9
17 0.9
18 0.9
19 0.9
20 0.91
21 0.91
22 0.91
23 0.9
24 0.84
25 0.82
26 0.73
27 0.62
28 0.59
29 0.49
30 0.41
31 0.4
32 0.4
33 0.32
34 0.35
35 0.35
36 0.3
37 0.3
38 0.27
39 0.2
40 0.17
41 0.15
42 0.11
43 0.09
44 0.07
45 0.06
46 0.06
47 0.05
48 0.04
49 0.04
50 0.05
51 0.06
52 0.07
53 0.07
54 0.12
55 0.15
56 0.21
57 0.24
58 0.26
59 0.26
60 0.27
61 0.28
62 0.27
63 0.26
64 0.2
65 0.18
66 0.15
67 0.15
68 0.14
69 0.13
70 0.12
71 0.16
72 0.19
73 0.19
74 0.26
75 0.28
76 0.37
77 0.46
78 0.52
79 0.55
80 0.59
81 0.6
82 0.56
83 0.62
84 0.57
85 0.54
86 0.55
87 0.57
88 0.55
89 0.62
90 0.63