Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317V5J6

Protein Details
Accession A0A317V5J6    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-43TGPSRDHRRRIPRAAGCRRMRRPDBasic
NLS Segment(s)
PositionSequence
27-33RRRIPRA
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRGMRGIRESGEGGRELSGTGPSRDHRRRIPRAAGCRRMRRPDEAFRLFAREHVTALVWIRPPDPYLVSFVLFSTSGSRQGGGPEIQALQAPRLAGATYASGPKAPGSPAAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.13
4 0.12
5 0.15
6 0.14
7 0.15
8 0.17
9 0.21
10 0.31
11 0.37
12 0.42
13 0.47
14 0.55
15 0.63
16 0.68
17 0.75
18 0.73
19 0.78
20 0.82
21 0.82
22 0.8
23 0.81
24 0.81
25 0.79
26 0.74
27 0.7
28 0.67
29 0.66
30 0.67
31 0.61
32 0.56
33 0.47
34 0.48
35 0.41
36 0.36
37 0.3
38 0.21
39 0.18
40 0.15
41 0.15
42 0.12
43 0.12
44 0.12
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.11
51 0.11
52 0.1
53 0.12
54 0.13
55 0.13
56 0.13
57 0.12
58 0.12
59 0.11
60 0.11
61 0.1
62 0.1
63 0.13
64 0.13
65 0.13
66 0.12
67 0.13
68 0.16
69 0.13
70 0.13
71 0.12
72 0.12
73 0.12
74 0.13
75 0.13
76 0.1
77 0.11
78 0.11
79 0.1
80 0.1
81 0.1
82 0.08
83 0.09
84 0.1
85 0.1
86 0.12
87 0.13
88 0.13
89 0.13
90 0.14
91 0.15
92 0.14