Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317V0U9

Protein Details
Accession A0A317V0U9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
64-86KARPANMTPTRRPRRRLNGGEPPHydrophilic
NLS Segment(s)
PositionSequence
74-79RRPRRR
Subcellular Location(s) mito 13, nucl 7, cyto 7, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR034595  NDUFAF8  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0032981  P:mitochondrial respiratory chain complex I assembly  
Amino Acid Sequences MPSTRIRPVEKFARATAKCSTEAAAYGKCVVADYNAVQKDMCAKEFLRLKDCFLVGPLPSTGQKARPANMTPTRRPRRRLNGGEPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.49
4 0.43
5 0.38
6 0.35
7 0.32
8 0.22
9 0.24
10 0.23
11 0.18
12 0.15
13 0.15
14 0.14
15 0.12
16 0.12
17 0.1
18 0.07
19 0.08
20 0.08
21 0.14
22 0.14
23 0.15
24 0.14
25 0.14
26 0.2
27 0.19
28 0.19
29 0.14
30 0.14
31 0.19
32 0.25
33 0.26
34 0.26
35 0.25
36 0.26
37 0.27
38 0.27
39 0.22
40 0.17
41 0.18
42 0.12
43 0.14
44 0.12
45 0.11
46 0.12
47 0.15
48 0.15
49 0.17
50 0.25
51 0.26
52 0.28
53 0.32
54 0.35
55 0.41
56 0.49
57 0.53
58 0.54
59 0.62
60 0.71
61 0.73
62 0.77
63 0.79
64 0.8
65 0.84
66 0.84