Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317WE78

Protein Details
Accession A0A317WE78    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
64-84RDPIKFPSLNRSHKRHQREKKBasic
NLS Segment(s)
PositionSequence
76-84HKRHQREKK
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 4, cyto 3.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011614  Catalase_core  
IPR020835  Catalase_sf  
Gene Ontology GO:0004096  F:catalase activity  
GO:0020037  F:heme binding  
Pfam View protein in Pfam  
PF00199  Catalase  
Amino Acid Sequences MDRSLDPFPGPPTGDSDRRHIPGAPCQTPTDSYIGTGKYTSGWISYSSRGLESLCPLQPVFFVRDPIKFPSLNRSHKRHQREKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.38
4 0.4
5 0.41
6 0.42
7 0.39
8 0.37
9 0.38
10 0.45
11 0.42
12 0.38
13 0.37
14 0.37
15 0.34
16 0.33
17 0.27
18 0.18
19 0.16
20 0.16
21 0.15
22 0.14
23 0.13
24 0.11
25 0.09
26 0.1
27 0.09
28 0.07
29 0.07
30 0.08
31 0.1
32 0.11
33 0.13
34 0.12
35 0.12
36 0.12
37 0.12
38 0.11
39 0.12
40 0.15
41 0.14
42 0.15
43 0.15
44 0.14
45 0.15
46 0.16
47 0.19
48 0.16
49 0.2
50 0.21
51 0.24
52 0.27
53 0.31
54 0.32
55 0.29
56 0.28
57 0.35
58 0.42
59 0.5
60 0.55
61 0.58
62 0.65
63 0.73
64 0.83